SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOL039W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL039W   Protein: S000005399
Sequence length 106
Comment RPP2A SGDID:S000005399, Chr XV from 254296-254616, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"
Sequence
MKYLAAYLLLNAAGNTPDATKIKAILESVGIEIEDEKVSSVLSALEGKSVDELITEGNEK
LAAVPAAGPASAGGAAAASGDAAAEEEKEEEAAEESDDDMGFGLFD
Download sequence
Identical sequences A6ZNH0 B3LJ19 C7GK08 E7KHQ0 E7NN88 E7Q938 E7QKH3 G2WMJ4 N1NVP6 P05319 W7PVD3 W7RDI4
YOL039W 3izc.v 3izc.w 3izs.v 3izs.w YOL039W SCRT_01363 YOL039W YOL039W YOL039W YOL039W YOL039W YR18 YOL039W YOL039W YOL039W YOL039W tr|A6ZNH0|A6ZNH0_YEAS7 YOL039W YOL039W 4932.YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W YOL039W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]