SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL081W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL081W
Domain Number 1 Region: 1672-2000
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-75
Family p120GAP domain-like 0.00011
Further Details:      
 

Protein sequence

External link(s) Locus: YOL081W   Protein: S000005441
Sequence length 3079
Comment IRA2 SGDID:S000005441, Chr XV from 171070-180309, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin"
Sequence
MSQPTKNKKKEHGTDSKSSRMTRTLVNHILFERILPILPVESNLSTYSEVEEYSSFISCR
SVLINVTVSRDANAMVEGTLELIESLLQGHEIISDKGSSDVIESILIILRLLSDALEYNW
QNQESLHYNDISTHVEHDQEQKYRPKLNSILPDYSSTHSNGNKHFFHQSKPQALIPELAS
KLLESCAKLKFNTRTLQILQNMISHVHGNILTTLSSSILPRHKSYLTRHNHPSHCKMIDS
TLGHILRFVAASNPSEYFEFIRKSVQVPVTQTHTHSHSHSHSLPSSVYNSIVPHFDLFSF
IYLSKHNFKKYLELIKNLSVTLRKTIYHCLLLHYSAKAIMFWIMARPAEYYELFNLLKDN
NNEHSKSLNTLNHTLFEEIHSTFNVNSMITTNQNAHQGSSSPSSSSPSSPPSSSSSDNNN
QNIIAKSLSRQLSHHQSYIQQQSERKLHSSWTTNSQSSTSLSSSTSNSTTTDFSTHTQPG
EYDPSLPDTPTMSNITISASSLLSQTPTPTTQLQQRLNSAAAAAAAAASPSNSTPTGYTA
EQQSRASYDAHKTGHTGKDYDEHFLSVTRLDNVLELYTHFDDTEVLPHTSVLKFLTTLTM
FDIDLFNELNATSFKYIPDCTMHRPKERTSSFNNTAHETGSEKTSGIKHITQGLKKLTSL
PSSTKKTVKFVKMLLRNLNGNQAVSDVALLDTMRALLSFFTMTSAVFLVDRNLPSVLFAK
RLIPIMGTNLSVGQDWNSKINNSLMVCLKKNSTTFVQLQLIFFSSAIQFDHELLLARLSI
DTMANNLNMQKLCLYTEGFRIFFDIPSKKELRKAIAVKISKFFKTLFSIIADILLQEFPY
FDEQITDIVASILDGTIINEYGTKKHFKGSSPSLCSTTRSRSGSTSQSSMTPVSPLGLDT
DICPMNTLSLVGSSTSRNSDNVNSLNSSPKNLSSDPYLSHLVAPRARHALGGPSSIIRNK
IPTTLTSPPGTEKSSPVQRPQTESISATPMAITNSTPLSSAAFGIRSPLQKIRTRRYSDE
SLGKFMKSTNNYIQEHLIPKDLNEATLQDARRIMINIFSIFKRPNSYFIIPHNINSNLQW
VSQDFRNIMKPIFVAIVSPDVDLQNTAQSFMDTLLSNVITYGESDENISIEGYHLLCSYT
VTLFAMGLFDLKINNEKRQILLDITVKFMKVRSHLAGIAEASHHMEYISDSEKLTFPLIM
GTVGRALFVSLYSSQQKIEKTLKIAYTEYLSAINFHERNIDDADKTWVHNIEFVEAMCHD
NYTTSGSIAFQRRTRNNILRFATIPNAILLDSMRMIYKKWHTYTHSKSLEKQERNDFRNF
AGILASLSGILFINKKILQEMYPYLLDTVSELKKNIDSFISKQCQWLNYPDLLTRENSRD
ILSVELHPLSFNLLFNNLRLKLKELACSDLSIPENESSYVLLEQIIKMLRTILGRDDDNY
VMMLFSTEIVDLIDLLTDEIKKIPAYCPKYLKAIIQMTKMFSALQHSEVNLGVKNHFHVK
NKWLRQITDWFQVSIAREYDFENLSKPLKEMDLVKRDMDILYIDTAIEASTAIAYLTRHT
FLEIPPAASDPELSRSRSVIFGFYFNILMKGLEKSSDRDNYPVFLRHKMSVLNDNVILSL
TNLSNTNVDASLQFTLPMGYSGNRNIRNAFLEVFINIVTNYRTYTAKTDLGKLEAADKFL
RYTIEHPQLSSFGAAVCPASDIDAYAAGLINAFETRNATHIVVAQLIKNEIEKSSRPTDI
LRRNSCATRSLSMLARSKGNEYLIRTLQPLLKKIIQNRDFFEIEKLKPEDSDAERQIELF
VKYMNELLESISNSVSYFPPPLFYICQNIYKVACEKFPDHAIIAAGSFVFLRFFCPALVS
PDSENIIDISHLSEKRTFISLAKVIQNIANGSENFSRWPALCSQKDFLKECSDRIFRFLA
ELCRTDRTIDIQVRTDPTPIAFDYQFLHSFVYLYGLEVRRNVLNEAKHDDGDIDGDDFYK
TTFLLIDDVLGQLGQPKMEFSNEIPIYIREHMDDYPELYEFMNRHAFRNIETSTAYSPSV
HESTSSEGIPIITLTMSNFSDRHVDIDTVAYKFLQIYARIWTTKHCLIIDCTEFDEGGLD
MRKFISLVMGLLPEVAPKNCIGCYYFNVNETFMDNYGKCLDKDNVYVSSKIPHYFINSNS
DEGLMKSVGITGQGLKVLQDIRVSLHDITLYDEKRNRFTPVSLKIGDIYFQVLHETPRQY
KIRDMGTLFDVKFNDVYEISRIFEVHVSSITGVAAEFTVTFQDERRLIFSSPKYLEIVKM
FYYAQIRLESEYEMDNNSSTSSPNSNNKDKQQKERTKLLCHLLLVSLIGLFDESKKMKNS
SYNLIAATEASFGLNFGSHFHRSPEVYVPEDTTTFLGVIGKSLAESNPELTAYMFIYVLE
ALKNNVIPHVYIPHTICGLSYWIPNLYQHVYLADDEEGPENISHIFRILIRLSVRETDFK
AVYMQYVWLLLLDDGRLTDIIVDEVINHALERDSENRDWKKTISLLTVLPTTEVANNIIQ
KILAKIRSFLPSLKLEAMTQSWSELTILVKISIHVFFETSLLVQMYLPEILFIVSLLIDV
GPRELRSSLHQLLMNVCHSLAINSALPQDHRNNLDEISDIFAHQKVKFMFGFSEDKGRIL
QIFSASSFASKFNILDFFINNILLLMEYSSTYEANVWKTRYKKYVLESVFTSNSFLSARS
IMIVGIMGKSYITEGLCKAMLIETMKVIAEPKITDEHLFLAISHIFTYSKIVEGLDPNLD
LMKHLFWFSTLFLESRHPIIFEGALLFVSNCIRRLYMAQFENESETSLISTLLKGRKFAH
TFLSKIENLSGIVWNEDNFTHILIFIINKGLSNPFIKSTAFDFLKMMFRNSYFEHQINQK
SDHYLCYMFLLYFVLNCNQFEELLGDVDFEGEMVNIENKNTIPKILLEWLSSDNENANIT
LYQGAILFKCSVTDEPSRFRFALIIRHLLTKKPICALRFYSVIRNEIRKISAFEQNSDCV
PLAFDILNLLVTHSESNSLEKLHEESIERLTKRGLSIVTSSGIFAKNSDMMIPLDVKPED
IYERKRIMTMILSRMSCSA
Download sequence
Identical sequences P19158
YOL081W YOL081W YOL081W 4932.YOL081W YOL081W YOL081W

Jump to [ Top of page · Domain architecture · Domain assignment details ]