SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL097W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOL097W-A   Protein: S000028854
Sequence length 61
Comment YOL097W-A SGDID:S000028854, Chr XV from 136220-136405, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry"
Sequence
MQSMICSSEHENLTCKYWPVSFLASWCENGSGTLMQKDGSLLYAVKNFSHIFEKKIFHTN
L
Download sequence
Identical sequences A6ZNB2 G2WMD7 Q3E7Y9
YOL097W-A 4932.YOL097W-A YOL097W-A YOL097W-A YOL097W-A YOL097W-A tr|A6ZNB2|A6ZNB2_YEAS7 YOL097W-A YOL097W-A YOL097W-A YOL097W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]