SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOL097W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL097W-A   Protein: S000028854
Sequence length 61
Comment YOL097W-A SGDID:S000028854, Chr XV from 136220-136405, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry"
Sequence
MQSMICSSEHENLTCKYWPVSFLASWCENGSGTLMQKDGSLLYAVKNFSHIFEKKIFHTN
L
Download sequence
Identical sequences A6ZNB2 G2WMD7 Q3E7Y9
YOL097W-A YOL097W-A YOL097W-A YOL097W-A YOL097W-A tr|A6ZNB2|A6ZNB2_YEAS7 YOL097W-A YOL097W-A 4932.YOL097W-A YOL097W-A YOL097W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]