SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL102C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL102C
Domain Number 1 Region: 12-201
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.19e-48
Family Tpt1/KptA 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transferase activity, transferring pentosyl groups 2.103 62.97
hydrolase activity, acting on glycosyl bonds 1.727 6.08
Cellular Component IC (bits) H-Score
cytosol 1.301 24.22
chromosomal part 1.477 8.95
side of membrane 1.701 8.29
external side of plasma membrane 1.827 8.29
synapse part 1.451 8.11
nucleolus 1.641 5.62
synaptic membrane 1.891 4.6

Protein sequence

External link(s) Locus: YOL102C   Protein: S000005462
Sequence length 230
Comment TPT1 SGDID:S000005462, Chr XV from 126689-125997, reverse complement, Verified ORF, "tRNA 2'-phosphotransferase, catalyzes the final step in yeast tRNA splicing: the transfer of the 2'-PO(4) from the splice junction to NAD(+) to form ADP-ribose 1''-2''cyclic phosphate and nicotinamide"
Sequence
MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDI
HRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTN
LQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKM
FRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI
Download sequence
Identical sequences N1NX51 Q12272
YOL102C YOL102C YOL102C YOL102C 355521 YOL102C 4932.YOL102C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]