SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL102C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL102C
Domain Number 1 Region: 12-201
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.19e-48
Family Tpt1/KptA 0.0078
Further Details:      
 

Protein sequence

External link(s) Locus: YOL102C   Protein: S000005462
Sequence length 230
Comment TPT1 SGDID:S000005462, Chr XV from 126689-125997, reverse complement, Verified ORF, "tRNA 2'-phosphotransferase, catalyzes the final step in yeast tRNA splicing: the transfer of the 2'-PO(4) from the splice junction to NAD(+) to form ADP-ribose 1''-2''cyclic phosphate and nicotinamide"
Sequence
MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDI
HRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTN
LQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKM
FRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI
Download sequence
Identical sequences N1NX51 Q12272
YOL102C YOL102C 4932.YOL102C YOL102C 355521 YOL102C YOL102C

Jump to [ Top of page · Domain architecture · Domain assignment details ]