SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL122C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOL122C   Protein: S000005482
Sequence length 575
Comment SMF1 SGDID:S000005482, Chr XV from 91419-89692, reverse complement, Verified ORF, "Divalent metal ion transporter with a broad specificity for di-valent and tri-valent metals; post-translationally regulated by levels of metal ions; member of the Nramp family of metal transport proteins"
Sequence
MVNVGPSHAAVAVDASEARKRNISEEVFELRDKKDSTVVIEGEAPVRTFTSSSSNHERED
TYVSKRQVMRDIFAKYLKFIGPGLMVSVAYIDPGNYSTAVDAGASNQFSLLCIILLSNFI
AIFLQCLCIKLGSVTGLDLSRACREYLPRWLNWTLYFFAECAVIATDIAEVIGTAIALNI
LIKVPLPAGVAITVVDVFLIMFTYKPGASSIRFIRIFECFVAVLVVGVCICFAIELAYIP
KSTSVKQVFRGFVPSAQMFDHNGIYTAISILGATVMPHSLFLGSALVQPRLLDYDVKHGN
YTVSEEQDKVKKSKSTEEIMEEKYFNYRPTNAAIKYCMKYSMVELSITLFTLALFVNCAI
LVVAGSTLYNSPEADGADLFTIHELLSRNLAPAAGTIFMLALLLSGQSAGVVCTMSGQIV
SEGHINWKLQPWQRRLATRCISIIPCLVISICIGREALSKALNASQVVLSIVLPFLVAPL
IFFTCKKSIMKTEITVDHTEEDSHNHQNNNDRSAGSVIEQDGSSGMEIENGKDVKIVYMA
NNWIITVIAIIVWLFLSLLNVYAIVQLGMSHGDIS
Download sequence
Identical sequences P38925
YOL122C YOL122C 4932.YOL122C YOL122C 2254S YOL122C YOL122C

Jump to [ Top of page · Domain architecture · Domain assignment details ]