SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL132W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL132W
Domain Number 1 Region: 25-319
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6e-57
Family beta-glycanases 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YOL132W   Protein: S000005492
Sequence length 471
Comment GAS4 SGDID:S000005492, Chr XV from 71300-72715, Verified ORF, "1,3-beta-glucanosyltransferase, involved with Gas2p in spore wall assembly; has similarity to Gas1p; localizes to the cell wall"
Sequence
MMVFSSTFIFLILELVVLCEASVHTIQIKDKHFVDTVTGKPFFIKGVDYQPGGSSDVSEK
QDPLSNPDACARDILLFQELGINTVRIYSINPDLNHDACMTMLAMAGIYLILDVNSPLQN
QHLNRYEPWTTYNEVYLEHVFKVVEQFSHYNNTLGFFAGNEIVNDKRSAQYSPAYVKELI
GTMKNYISAHSPRTIPVGYSAADDLNYRVSLSEYLECKDDDKPENSVDFYGVNSYQWCGQ
QTMQTSGYDTLVDAYRSYSKPVFFSEFGCNKVLPRQFQEIGYLFSEEMYSVFCGGLVYEF
SQEDNNYGLVEYQEDDSVQLLADFEKLKSHYQNIEFPSMKTLKETVQMEETPSCAEDYEN
LKIESKIAKNLGSSLIKKGVKVEKGKYIDIHEDQLSTNVTILDKHGDRWNGPKKIEIRQS
LTLADLEGEEQEDADEDKDDLKRKHRNSASISGPLLPLGLCLLFFTFSLFF
Download sequence
Identical sequences A6ZN79 C7GV08 G2WMA5 N1P3A1 Q08271 W7R5N9
YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W 4932.YOL132W YOL132W YOL132W tr|A6ZN79|A6ZN79_YEAS7 YOL132W YOL132W YOL132W YOL132W

Jump to [ Top of page · Domain architecture · Domain assignment details ]