SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOL132W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL132W
Domain Number 1 Region: 25-319
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6e-57
Family beta-glycanases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.693 21.25
site of polarized growth 1.678 11.01
actin cytoskeleton 1.332 11.01
side of membrane 1.587 8.32
external side of plasma membrane 1.885 8.32
actin-based cell projection 1.641 7.09
membrane region 1.557 6.97
cell-cell junction 1.437 6.08
symplast 2.048 5.61
apical plasma membrane 1.458 5.38

Protein sequence

External link(s) Locus: YOL132W   Protein: S000005492
Sequence length 471
Comment GAS4 SGDID:S000005492, Chr XV from 71300-72715, Verified ORF, "1,3-beta-glucanosyltransferase, involved with Gas2p in spore wall assembly; has similarity to Gas1p; localizes to the cell wall"
Sequence
MMVFSSTFIFLILELVVLCEASVHTIQIKDKHFVDTVTGKPFFIKGVDYQPGGSSDVSEK
QDPLSNPDACARDILLFQELGINTVRIYSINPDLNHDACMTMLAMAGIYLILDVNSPLQN
QHLNRYEPWTTYNEVYLEHVFKVVEQFSHYNNTLGFFAGNEIVNDKRSAQYSPAYVKELI
GTMKNYISAHSPRTIPVGYSAADDLNYRVSLSEYLECKDDDKPENSVDFYGVNSYQWCGQ
QTMQTSGYDTLVDAYRSYSKPVFFSEFGCNKVLPRQFQEIGYLFSEEMYSVFCGGLVYEF
SQEDNNYGLVEYQEDDSVQLLADFEKLKSHYQNIEFPSMKTLKETVQMEETPSCAEDYEN
LKIESKIAKNLGSSLIKKGVKVEKGKYIDIHEDQLSTNVTILDKHGDRWNGPKKIEIRQS
LTLADLEGEEQEDADEDKDDLKRKHRNSASISGPLLPLGLCLLFFTFSLFF
Download sequence
Identical sequences A6ZN79 C7GV08 G2WMA5 N1P3A1 Q08271
YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W YOL132W tr|A6ZN79|A6ZN79_YEAS7 YOL132W 4932.YOL132W YOL132W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]