SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOL142W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL142W
Domain Number 1 Region: 62-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-23
Family Cold shock DNA-binding domain-like 0.0000118
Further Details:      
 
Domain Number 2 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.138 52.55
dendrite 1.581 47.86
replication fork 2.17 36.28
chromosomal region 1.966 30.26
site of polarized growth 1.678 28.16
protein-DNA complex 1.891 25.87
aminoacyl-tRNA synthetase multienzyme complex 2.17 24.91
nuclear chromosome part 1.803 23.69
cytoplasmic region 1.531 23.12
ribosomal subunit 1.939 22.18

Protein sequence

External link(s) Locus: YOL142W   Protein: S000005502
Sequence length 240
Comment RRP40 SGDID:S000005502, Chr XV from 55557-56279, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex"
Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYS
SKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVY
ARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNFNFARQLLFNNDFPLLKVLAA
HTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE
Download sequence
Identical sequences 4932.YOL142W YOL142W 355010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]