SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL142W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL142W
Domain Number 1 Region: 62-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-23
Family Cold shock DNA-binding domain-like 1.18e-05
Further Details:      
 
Domain Number 2 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-21
Family Eukaryotic type KH-domain (KH-domain type I) 4.49e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.13
replication fork 2.198 34.31
nucleoplasm part 1.418 33.7
nuclear chromosome 1.72 24.48
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.418 20.29
ribosomal subunit 2.011 19.49
small nuclear ribonucleoprotein complex 2.005 13.92
DNA-directed RNA polymerase complex 2.005 12.25
ribonucleoprotein granule 1.999 10.35
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 1.996 68.7
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.887 44.68
tRNA aminoacylation 2.002 39.07
translation 1.521 35.23
telomere organization 2.104 26.38
RNA processing 1.458 21.38
mRNA metabolic process 1.627 21.38
RNA 3'-end processing 2.027 21.38
sex differentiation 1.6 21.27

Protein sequence

External link(s) Locus: YOL142W   Protein: S000005502
Sequence length 240
Comment RRP40 SGDID:S000005502, Chr XV from 55557-56279, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex"
Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYS
SKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVY
ARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNFNFARQLLFNNDFPLLKVLAA
HTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE
Download sequence
Identical sequences YOL142W 4932.YOL142W 355010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]