SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL142W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL142W
Domain Number 1 Region: 62-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-23
Family Cold shock DNA-binding domain-like 0.0000118
Further Details:      
 
Domain Number 2 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
DNA replication 1.891 48.73
DNA duplex unwinding 1.985 47.01
double-strand break repair 1.882 44.57
tRNA aminoacylation 2.003 38.49
translation 1.518 35.28
DNA repair 1.506 32.47
single-organism behavior 1.288 30.14
telomere organization 2.075 26.4
reproductive structure development 1.278 22.64
sex differentiation 1.588 22.64
Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.26
nucleoplasm part 1.496 33.77
replication fork 2.208 33.63
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.414 20.38
ribosomal subunit 2.011 19.55
small nuclear ribonucleoprotein complex 2.005 14.05
transferase complex 1.423 12.34
DNA repair complex 2.141 10.11
chromosomal region 1.98 9.54

Protein sequence

External link(s) Locus: YOL142W   Protein: S000005502
Sequence length 240
Comment RRP40 SGDID:S000005502, Chr XV from 55557-56279, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex"
Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYS
SKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVY
ARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNFNFARQLLFNNDFPLLKVLAA
HTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE
Download sequence
Identical sequences 4932.YOL142W YOL142W 355010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]