SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL142W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL142W
Domain Number 1 Region: 62-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-23
Family Cold shock DNA-binding domain-like 1.18e-05
Further Details:      
 
Domain Number 2 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-21
Family Eukaryotic type KH-domain (KH-domain type I) 4.49e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YOL142W   Protein: S000005502
Sequence length 240
Comment RRP40 SGDID:S000005502, Chr XV from 55557-56279, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex"
Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYS
SKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVY
ARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNFNFARQLLFNNDFPLLKVLAA
HTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE
Download sequence
Identical sequences YOL142W 4932.YOL142W 355010

Jump to [ Top of page · Domain architecture · Domain assignment details ]