SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOL147C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL147C   Protein: S000005507
Sequence length 236
Comment PEX11 SGDID:S000005507, Chr XV from 48642-47932, reverse complement, Verified ORF, "Peroxisomal membrane protein required for peroxisome proliferation and medium-chain fatty acid oxidation, most abundant protein in the peroxisomal membrane, regulated by Adr1p and Pip2p-Oaf1p, promoter contains ORE and UAS1-like elements"
Sequence
MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRK
FLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVT
VLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLG
KAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT
Download sequence
Identical sequences A6ZN65 B3LIS0 B5VRB5 C7GV22 C8ZHH0 E7KHX2 E7KTV1 E7LZW4 E7Q8Y8 G2WM91 H0GMZ1 N1NVQ5 Q12462 W7PKG9 W7QQW0
YOL147C YOL147C YOL147C 4932.YOL147C YOL147C YOL147C tr|A6ZN65|A6ZN65_YEAS7 YOL147C YOL147C YOL147C YOL147C YOL147C YOL147C SCRT_01260 YOL147C YOL147C YOL147C YOL147C YOL147C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]