SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL164W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL164W
Domain Number 1 Region: 18-515
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.14e-154
Family Alkylsulfatase-like 3.49e-10
Further Details:      
 
Domain Number 2 Region: 524-641
Classification Level Classification E-value
Superfamily SCP-like 3.06e-27
Family Alkylsulfatase C-terminal domain-like 0.0015
Further Details:      
 

Protein sequence

External link(s) Locus: YOL164W   Protein: S000005524
Sequence length 646
Comment BDS1 SGDID:S000005524, Chr XV from 6175-8115, Verified ORF, "Bacterially-derived sulfatase required for use of alkyl- and aryl-sulfates as sulfur sources"
Sequence
MIGAFKRNRGSSQSFAKECQPSTLKANLEVAKELPFSDRRDFEDATQGYIGSLSDEQIIG
PDGGVVWCMKSYGFLEPETPANTVNPSLWRQAQLNAIHGLFKITDNVYQVRGLDISNMTI
IEGNTSLIIIDTLFTTETAQESLKLYYRHRPQKPVRTVIYTHSHSDHYGGVKGIVKEADV
KSGEVQIIAPVGFMESVVAENILAGNAMHRRSQYQFGMLLSPSVKGHVDCGIGKAASHGT
VTLIAPTIIIEEPVEERTIDGVDFVFQLAPGSEAPSEMLIYMPQQRVLNMAEDVTHHMHN
LYALRGVEVRDGNQWAKYIDAARVAFGSKTDVLIAQHHWPTTGQMRINELLKKQRDMYKF
IHDQTLRLLNQGYTSRDIAETLRMPSSLEQEWSTRGYYGTLSHNVKAVYQKYLGWYDANP
ANLNPLPPVAYAKKAVEYMGGADAVLARAYKDFQKGEFRWVASVVNQLVFADPNNHQARE
LCADALEQLGYQAEASTWRNAYLVGAMELRQGVPKRRSTGKRNNIAVLNNEMFFDFLAVR
LNATKAEGKIIVSNWCFINSNERFVITLENCALTYIQGWQTDADATITLKRTTFEALLAN
EITMVDFLRSKEVEIEGNRLRIEELLKLFDDFDQSFPVVEPMGGST
Download sequence
Identical sequences N1NWH2 Q08347
YOL164W YOL164W 4932.YOL164W YOL164W YOL164W YOL164W

Jump to [ Top of page · Domain architecture · Domain assignment details ]