SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL164W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL164W
Domain Number 1 Region: 18-515
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.14e-154
Family Alkylsulfatase-like 0.000000000349
Further Details:      
 
Domain Number 2 Region: 524-641
Classification Level Classification E-value
Superfamily SCP-like 3.06e-27
Family Alkylsulfatase C-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.95 23.69
transferase complex 1.423 19.68
RNA polymerase complex 1.998 19.68
nucleoplasm part 1.496 13.62
lipid particle 1.469 8.81
chromosomal part 1.477 7.84
chromosomal region 1.98 7.84

Protein sequence

External link(s) Locus: YOL164W   Protein: S000005524
Sequence length 646
Comment BDS1 SGDID:S000005524, Chr XV from 6175-8115, Verified ORF, "Bacterially-derived sulfatase required for use of alkyl- and aryl-sulfates as sulfur sources"
Sequence
MIGAFKRNRGSSQSFAKECQPSTLKANLEVAKELPFSDRRDFEDATQGYIGSLSDEQIIG
PDGGVVWCMKSYGFLEPETPANTVNPSLWRQAQLNAIHGLFKITDNVYQVRGLDISNMTI
IEGNTSLIIIDTLFTTETAQESLKLYYRHRPQKPVRTVIYTHSHSDHYGGVKGIVKEADV
KSGEVQIIAPVGFMESVVAENILAGNAMHRRSQYQFGMLLSPSVKGHVDCGIGKAASHGT
VTLIAPTIIIEEPVEERTIDGVDFVFQLAPGSEAPSEMLIYMPQQRVLNMAEDVTHHMHN
LYALRGVEVRDGNQWAKYIDAARVAFGSKTDVLIAQHHWPTTGQMRINELLKKQRDMYKF
IHDQTLRLLNQGYTSRDIAETLRMPSSLEQEWSTRGYYGTLSHNVKAVYQKYLGWYDANP
ANLNPLPPVAYAKKAVEYMGGADAVLARAYKDFQKGEFRWVASVVNQLVFADPNNHQARE
LCADALEQLGYQAEASTWRNAYLVGAMELRQGVPKRRSTGKRNNIAVLNNEMFFDFLAVR
LNATKAEGKIIVSNWCFINSNERFVITLENCALTYIQGWQTDADATITLKRTTFEALLAN
EITMVDFLRSKEVEIEGNRLRIEELLKLFDDFDQSFPVVEPMGGST
Download sequence
Identical sequences N1NWH2 Q08347
4932.YOL164W YOL164W YOL164W YOL164W YOL164W YOL164W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]