SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL164W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOL164W-A   Protein: S000028580
Sequence length 60
Comment YOL164W-A SGDID:S000028580, Chr XV from 4130-4312, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MFAKLYRGLTYVTNKILSTLLSHHSIHYCINSFKPTTLAIIILLHPCCRCNVYIIRCIHH
Download sequence
Identical sequences Q3E7A5
YOL164W-A YOL164W-A YOL164W-A 4932.YOL164W-A YOL164W-A YOL164W-A YOL164W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]