SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR008W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR008W-B   Protein: S000007628
Sequence length 33
Comment YOR008W-B SGDID:S000007628, Chr XV from 343929-344030, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MATKGNLKRQTKYFSTIAYTETRGEATLRANYQ
Download sequence
Identical sequences C8ZHX3 P0C5Q9 W7PKW1
YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B 4932.YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]