SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR008W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR008W-B   Protein: S000007628
Sequence length 33
Comment YOR008W-B SGDID:S000007628, Chr XV from 343929-344030, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MATKGNLKRQTKYFSTIAYTETRGEATLRANYQ
Download sequence
Identical sequences C8ZHX3 P0C5Q9 W7PKW1
YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B 4932.YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B YOR008W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]