SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR011W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR011W-A   Protein: S000028581
Sequence length 68
Comment YOR011W-A SGDID:S000028581, Chr XV from 355652-355858, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWCLYITTDKKII
KKKDFYHR
Download sequence
Identical sequences Q3E807
YOR011W-A YOR011W-A YOR011W-A 4932.YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]