SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR011W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR011W-A   Protein: S000028581
Sequence length 68
Comment YOR011W-A SGDID:S000028581, Chr XV from 355652-355858, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWCLYITTDKKII
KKKDFYHR
Download sequence
Identical sequences Q3E807
YOR011W-A YOR011W-A YOR011W-A 4932.YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A YOR011W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]