SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR026W
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-36
Family Cell cycle arrest protein BUB3 0.0000000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR026W   Protein: S000005552
Sequence length 341
Comment BUB3 SGDID:S000005552, Chr XV from 379781-380806, Verified ORF, "Kinetochore checkpoint WD40 repeat protein that localizes to kinetochores during prophase and metaphase, delays anaphase in the presence of unattached kinetochores; forms complexes with Mad1p-Bub1p and with Cdc20p, binds Mad2p and Mad3p"
Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Download sequence
Identical sequences A0A250WB46 P26449
4932.YOR026W YOR026W cath|current|2i3tA00/1-340 cath|current|2i3tC00/1-340 cath|current|2i3tE00/1-340 cath|current|2i3tG00/1-340 cath|current|4bl0A00/1-340 cath|current|4bl0D00/1-340 d1yfqa1 354935 YOR026W 2i3t.A 2i3t.C 2i3t.E 2i3t.G 4bl0.A 4bl0.D YOR026W YOR026W YOR026w___KOG1036 2i3tA NP_014669.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]