SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR026W
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-36
Family Cell cycle arrest protein BUB3 1.26e-11
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YOR026W   Protein: S000005552
Sequence length 341
Comment BUB3 SGDID:S000005552, Chr XV from 379781-380806, Verified ORF, "Kinetochore checkpoint WD40 repeat protein that localizes to kinetochores during prophase and metaphase, delays anaphase in the presence of unattached kinetochores; forms complexes with Mad1p-Bub1p and with Cdc20p, binds Mad2p and Mad3p"
Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Download sequence
Identical sequences P26449
YOR026W 2i3tA 4932.YOR026W YOR026W YOR026W 2i3t.A 2i3t.C 2i3t.E 2i3t.G 4bl0.A 4bl0.D YOR026w___KOG1036 354935 YOR026W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]