SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR026W
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-36
Family Cell cycle arrest protein BUB3 0.0000000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2

Protein sequence

External link(s) Locus: YOR026W   Protein: S000005552
Sequence length 341
Comment BUB3 SGDID:S000005552, Chr XV from 379781-380806, Verified ORF, "Kinetochore checkpoint WD40 repeat protein that localizes to kinetochores during prophase and metaphase, delays anaphase in the presence of unattached kinetochores; forms complexes with Mad1p-Bub1p and with Cdc20p, binds Mad2p and Mad3p"
Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Download sequence
Identical sequences P26449
YOR026W YOR026W 354935 YOR026W YOR026w___KOG1036 2i3tA 4932.YOR026W 2i3t.A 2i3t.C 2i3t.E 2i3t.G 4bl0.A 4bl0.D YOR026W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]