SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR026W
Domain Number 1 Region: 2-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-36
Family Cell cycle arrest protein BUB3 1.26e-11
Further Details:      
 

Protein sequence

External link(s) Locus: YOR026W   Protein: S000005552
Sequence length 341
Comment BUB3 SGDID:S000005552, Chr XV from 379781-380806, Verified ORF, "Kinetochore checkpoint WD40 repeat protein that localizes to kinetochores during prophase and metaphase, delays anaphase in the presence of unattached kinetochores; forms complexes with Mad1p-Bub1p and with Cdc20p, binds Mad2p and Mad3p"
Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Download sequence
Identical sequences P26449
YOR026W 2i3tA 4932.YOR026W YOR026W YOR026W 2i3t.A 2i3t.C 2i3t.E 2i3t.G YOR026w___KOG1036 354935 YOR026W

Jump to [ Top of page · Domain architecture · Domain assignment details ]