SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOR073W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR073W-A   Protein: S000028583
Sequence length 77
Comment YOR073W-A SGDID:S000028583, Chr XV from 467392-467625, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially/completely overlaps the verified ORF CDC21/YOR074C; identified by RT-PCR"
Sequence
MIPLVKTFLVVSSGKVSSRKLKRSWGGAKRLNVPVPVLSGLNSPSSMILLHRSRYCSSSL
FFPSIVILYRSVMKLSP
Download sequence
Identical sequences C8ZI36 P0C5R3 W7PL17
YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A 4932.YOR073W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]