SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR073W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR073W-A   Protein: S000028583
Sequence length 77
Comment YOR073W-A SGDID:S000028583, Chr XV from 467392-467625, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially/completely overlaps the verified ORF CDC21/YOR074C; identified by RT-PCR"
Sequence
MIPLVKTFLVVSSGKVSSRKLKRSWGGAKRLNVPVPVLSGLNSPSSMILLHRSRYCSSSL
FFPSIVILYRSVMKLSP
Download sequence
Identical sequences C8ZI36 P0C5R3
YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A 4932.YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A YOR073W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]