SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR117W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR117W
Domain Number 1 Region: 177-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.18e-64
Family Extended AAA-ATPase domain 2.34e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribonucleoprotein complex 1.418 9.43
DNA-directed RNA polymerase complex 2.005 9.42

Protein sequence

External link(s) Locus: YOR117W   Protein: S000005643
Sequence length 434
Comment RPT5 SGDID:S000005643, Chr XV from 545030-546334, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription"
Sequence
MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLE
KIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVK
TSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETY
SDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTN
ATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDRE
VQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQI
LQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIS
EVQARKSKSVSFYA
Download sequence
Identical sequences A6ZNW5 B3LJG0 C7GML9 C8ZI79 E7M0C5 E7NMZ9 E7Q9N5 E7QKQ7 G2WMZ3 H0GNN5 J8PHZ0 N1NWL4 P33297 W7PCX0 W7R4U6
YOR117W YOR117W YOR117W YOR117W YOR117W YOR117W YOR117W YOR117W YOR117W 4932.YOR117W YOR117W YOR117W SCRT_01513 YOR117W tr|A6ZNW5|A6ZNW5_YEAS7 4b4t.M 4bgr.M 4c0v.M 4cr2.M 4cr3.M 4cr4.M YOR117W YOR117W YOR117W YOR117W YOR117W YOR117W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]