SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR142W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR142W-A
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0152
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Protein sequence

External link(s) Locus: YOR142W-A   Protein: S000007351
Sequence length 440
Comment YOR142W-A SGDID:S000007351, Chr XV from 595113-596435, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRPITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences P0CX59 P0CX60
YOR142W-A YPR158W-A 4932.YOR142W-A 4932.YPR158W-A YOR142W-A YPR158W-A YR234 YOR142W-A YPR158W-A YPR158W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]