SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR144C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR144C
Domain Number 1 Region: 240-276,314-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-16
Family Extended AAA-ATPase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YOR144C   Protein: S000005670
Sequence length 791
Comment ELG1 SGDID:S000005670, Chr XV from 605093-602718, reverse complement, Verified ORF, "Protein required for S phase progression and telomere homeostasis, forms an alternative replication factor C complex important for DNA replication and genome integrity; involved in homologous recombination-mediated DNA repair"
Sequence
MKRHVSLSDILTGNKRKVRRQDALQITIDDENDTESGTFDARTAKHDDSSVIFLNHSVVK
PIEAVSTNHKSAKEFLMTKRTKEKCDDDDDDLIVISDKSPKSETNCSKIALSQEHEDDIS
IISTSRIKSSLLNERASKIKNFLKHETTDTFKRLNSISKLNEIEPPLPLHQSIFPVGDKE
LSDRSVDIPLPFRTIPPLNHNFLPSDYESLKDKNSASCIPVRYQAPVLLGTNIKRNTTLT
WPQLFKPVTLKQVLIEPKLKLRIKNWIETSFHTLEKPTLRNRLLNRINPNKQQGSGDELA
NFIVPDLEEDENLRPDFYRNGEANSSLSEFVPLMILHGNSIGKKTLIQTIMREIAGDDNS
YQIYEVNSNMNRSKKDLLDILLDFTTTHYVKDSSKRKSDYGLVLFNDVDVLFKEHDRGYW
AMISKLCEFSRRPLVLTCKDLSLVPSELIALASEQNSLFHTKKISTSTVYAFLTKYLKSL
EIEVCDDWLRDVVKQNNADIRKCLMHLQFWCVDTEADLISSKNRLPVLTSTLGSSVKDIS
QLTDLLSINDVIGQATLNRSMVRQEIDSTTMTPEKVNTFQDQNLDDEMKLKFDYVIDYKL
HLNDPNRQPLLPFELNIYQHIQEQLEARYSYVREANHRLDNEYLVNRFKKMTESTLNFLA
SRIPKYDHLQSARRTRNSKKISDILNQFKGIYNDETLNENAEIDLLSATTQQIKAEINPF
VFEIAKSDANVKNENKQIFELHSENVSERRYKDLVYQLSQEGVLKNVWFNADPSIVVRKW
EHLHSGFSKNK
Download sequence
Identical sequences C7GN79 Q12050
YOR144C 4932.YOR144C YOR144C YOR144C YOR144C YOR144C YOR144C YOR144C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]