SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR144C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR144C
Domain Number 1 Region: 240-276,314-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-16
Family Extended AAA-ATPase domain 0.013
Further Details:      
 

Protein sequence

External link(s) Locus: YOR144C   Protein: S000005670
Sequence length 791
Comment ELG1 SGDID:S000005670, Chr XV from 605093-602718, reverse complement, Verified ORF, "Protein required for S phase progression and telomere homeostasis, forms an alternative replication factor C complex important for DNA replication and genome integrity; involved in homologous recombination-mediated DNA repair"
Sequence
MKRHVSLSDILTGNKRKVRRQDALQITIDDENDTESGTFDARTAKHDDSSVIFLNHSVVK
PIEAVSTNHKSAKEFLMTKRTKEKCDDDDDDLIVISDKSPKSETNCSKIALSQEHEDDIS
IISTSRIKSSLLNERASKIKNFLKHETTDTFKRLNSISKLNEIEPPLPLHQSIFPVGDKE
LSDRSVDIPLPFRTIPPLNHNFLPSDYESLKDKNSASCIPVRYQAPVLLGTNIKRNTTLT
WPQLFKPVTLKQVLIEPKLKLRIKNWIETSFHTLEKPTLRNRLLNRINPNKQQGSGDELA
NFIVPDLEEDENLRPDFYRNGEANSSLSEFVPLMILHGNSIGKKTLIQTIMREIAGDDNS
YQIYEVNSNMNRSKKDLLDILLDFTTTHYVKDSSKRKSDYGLVLFNDVDVLFKEHDRGYW
AMISKLCEFSRRPLVLTCKDLSLVPSELIALASEQNSLFHTKKISTSTVYAFLTKYLKSL
EIEVCDDWLRDVVKQNNADIRKCLMHLQFWCVDTEADLISSKNRLPVLTSTLGSSVKDIS
QLTDLLSINDVIGQATLNRSMVRQEIDSTTMTPEKVNTFQDQNLDDEMKLKFDYVIDYKL
HLNDPNRQPLLPFELNIYQHIQEQLEARYSYVREANHRLDNEYLVNRFKKMTESTLNFLA
SRIPKYDHLQSARRTRNSKKISDILNQFKGIYNDETLNENAEIDLLSATTQQIKAEINPF
VFEIAKSDANVKNENKQIFELHSENVSERRYKDLVYQLSQEGVLKNVWFNADPSIVVRKW
EHLHSGFSKNK
Download sequence
Identical sequences C7GN79 Q12050
YOR144C 4932.YOR144C YOR144C YOR144C YOR144C YOR144C YOR144C YOR144C

Jump to [ Top of page · Domain architecture · Domain assignment details ]