SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR163W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR163W
Domain Number 1 Region: 29-111
Classification Level Classification E-value
Superfamily Nudix 2.57e-19
Family MutT-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.369 31.96
microbody 1.856 12.08
ribosomal subunit 1.983 8.2
organellar ribosome 2.107 6.09
cytoplasmic ribonucleoprotein granule 1.929 6.02
mitochondrial matrix 1.611 5.64
intracellular ribonucleoprotein complex 1.368 3.68

Protein sequence

External link(s) Locus: YOR163W   Protein: S000005689
Sequence length 188
Comment DDP1 SGDID:S000005689, Chr XV from 642742-643308, Verified ORF, "Polyphosphate phosphatase; hydrolyzes diphosphorylated inositol polyphosphates and diadenosine polyphosphates; has high specificity for diadenosine hexa- and pentaphosphates; member of the MutT family of nucleotide hydrolases"
Sequence
MGKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWI
VPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKD
SEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNR
SAIIKDDK
Download sequence
Identical sequences A6ZP08 B3LJJ6 C7GN61 C8ZGS4 E7KI62 E7KUG5 E7M0F6 E7NN22 E7Q9R7 E7QKT3 H0GNJ0 N1NWP4 Q99321
YOR163W YOR163W 4932.YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W tr|A6ZP08|A6ZP08_YEAS7 YOR163W YOR163W YOR163W 354937 YOR163W SCRT_01556 YOR163W YOR163W YOR163W YOR163W YOR163W YOR163W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]