SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR180C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR180C
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.37e-36
Family Crotonase-like 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.816 19.15
chloroplast part 1.842 18.82
plastid stroma 1.982 18.82
thylakoid 2.204 8.1
mitochondrial matrix 1.568 7.71
lipid particle 1.395 7.26
plastid envelope 2.242 5.7
cell wall 1.769 5.26
organelle subcompartment 1.51 4.68
external encapsulating structure 1.708 4.47

Protein sequence

External link(s) Locus: YOR180C   Protein: S000005706
Sequence length 271
Comment DCI1 SGDID:S000005706, Chr XV from 675168-674353, reverse complement, Verified ORF, "Peroxisomal delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, involved in fatty acid metabolism, contains peroxisome targeting signals at amino and carboxy termini"
Sequence
MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLFTVLQSSGKYF
SSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVANAFAIHKKVLVCCLNGPAIGL
SASLVALCDIVYSQNDSVFLLFPFSNLGFVAEVGTSVTLTQKLGINSANEHMIFSTPVLF
KELIGTIITKNYQLTNTETFNEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQA
METNGTLPFWASGEPFKRFKQLQEGNRRHKL
Download sequence
Identical sequences C7GLR3 C8ZGU1 G2WN53 N1NX35 Q08558 W7PW24 W7QV61
YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C YOR180C 4932.YOR180C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]