SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR188W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR188W
Domain Number - Region: 127-235
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0419
Family BCR-homology GTPase activation domain (BH-domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR188W   Protein: S000005714
Sequence length 1137
Comment MSB1 SGDID:S000005714, Chr XV from 685768-689181, Verified ORF, "Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway, potential Cdc28p substrate; multicopy suppressor of temperature-sensitive mutations in CDC24 and CDC42, and of mutations in BEM4"
Sequence
MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGRTKNEHNSMDD
EEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFRPEQTNDKLLTLLNQLFPLGN
GQPVNEKKQLRIVSKADVWTLFQCLKYIWCRLPNSEIIGWKSYLEFKFREEDKKFPRKSF
LEIMPQCLASPNHASIVYDFFDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQ
DYDFESAAMKSFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL
LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFSDHDAFEARED
YALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQPGWAPRECIENISHLKECIE
VKRLDIDDYFIWTWLSSLSFEQTSEKKKIFGRSIILEFEFDGFKKWVVFQECDITLDYNK
KGQLKKKTSAQSPTTEKELPPDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAP
DNQGIYHTVISKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA
PIREEYHTNKNHKSKKEERVLSQFSTLNPDEYQLPVIETGSSNFKIEIPELMYEHDDDDS
DKLKNSQKRATDSAIEELNGMVEEMMINEPDDVKISITEAETFESLTKFDQYKPSNITDD
DLQSSHSSAVHSLKLSTNTNDSCADSSKYTADRKLAEPRKISEESKVNDDSSSYYSPNIN
NLPASRMPSQPTYSNSDSKKAFTNESRLNVLQGAVSPSQQVTPKPYKNAPGDCVSPVQQK
YYQNDRRNEMSPASAPVPPSAYSPARSPQFSTNSAGFKQNTINVPVGYNDPAHVLANQPH
MTYRDQHNYPSHQQKQRPFQNNIVPPELKSRNQRADASPIPQHMVPVKQGVPNLPSNVPL
YQQMERMNPNHQHPVNTYKVTQPPYHNNTTNAYGNSRAGNAHMLDGKWSNNPPQMVPKGV
RPNQYPQQHVNRYSPQAQPVVPAEYYNGPPPMRAPPMMSHMVPAQEPIRYTAGANRRSFP
QGMQQNAYSVPAQPMGAVNSEFYLPEAPQGNKLHGNINKRQERKKLYDNIRSGNFGI
Download sequence
Identical sequences P21339
YOR188W YOR188W 4932.YOR188W YOR188W YOR188W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]