SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR188W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR188W
Domain Number - Region: 127-235
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0419
Family BCR-homology GTPase activation domain (BH-domain) 0.021
Further Details:      
 

Protein sequence

External link(s) Locus: YOR188W   Protein: S000005714
Sequence length 1137
Comment MSB1 SGDID:S000005714, Chr XV from 685768-689181, Verified ORF, "Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway, potential Cdc28p substrate; multicopy suppressor of temperature-sensitive mutations in CDC24 and CDC42, and of mutations in BEM4"
Sequence
MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGRTKNEHNSMDD
EEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFRPEQTNDKLLTLLNQLFPLGN
GQPVNEKKQLRIVSKADVWTLFQCLKYIWCRLPNSEIIGWKSYLEFKFREEDKKFPRKSF
LEIMPQCLASPNHASIVYDFFDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQ
DYDFESAAMKSFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL
LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFSDHDAFEARED
YALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQPGWAPRECIENISHLKECIE
VKRLDIDDYFIWTWLSSLSFEQTSEKKKIFGRSIILEFEFDGFKKWVVFQECDITLDYNK
KGQLKKKTSAQSPTTEKELPPDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAP
DNQGIYHTVISKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA
PIREEYHTNKNHKSKKEERVLSQFSTLNPDEYQLPVIETGSSNFKIEIPELMYEHDDDDS
DKLKNSQKRATDSAIEELNGMVEEMMINEPDDVKISITEAETFESLTKFDQYKPSNITDD
DLQSSHSSAVHSLKLSTNTNDSCADSSKYTADRKLAEPRKISEESKVNDDSSSYYSPNIN
NLPASRMPSQPTYSNSDSKKAFTNESRLNVLQGAVSPSQQVTPKPYKNAPGDCVSPVQQK
YYQNDRRNEMSPASAPVPPSAYSPARSPQFSTNSAGFKQNTINVPVGYNDPAHVLANQPH
MTYRDQHNYPSHQQKQRPFQNNIVPPELKSRNQRADASPIPQHMVPVKQGVPNLPSNVPL
YQQMERMNPNHQHPVNTYKVTQPPYHNNTTNAYGNSRAGNAHMLDGKWSNNPPQMVPKGV
RPNQYPQQHVNRYSPQAQPVVPAEYYNGPPPMRAPPMMSHMVPAQEPIRYTAGANRRSFP
QGMQQNAYSVPAQPMGAVNSEFYLPEAPQGNKLHGNINKRQERKKLYDNIRSGNFGI
Download sequence
Identical sequences P21339
YOR188W YOR188W 4932.YOR188W YOR188W YOR188W

Jump to [ Top of page · Domain architecture · Domain assignment details ]