SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR192C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR192C-A   Protein: S000007353
Sequence length 438
Comment YOR192C-A SGDID:S000007353, Chr XV from 709733-708417, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQNSPTFHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIGSQDQHSEVPQAKTKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YSDILTVLCKSVSKMQTNNQELKDWIALANLEYNGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences Q12439
YOR192C-A 4932.YOR192C-A YOR192C-A YOR192C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]