SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR211C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR211C
Domain Number 1 Region: 185-419,450-511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-51
Family G proteins 4.48e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YOR211C   Protein: S000005737
Sequence length 881
Comment MGM1 SGDID:S000005737, Chr XV from 741570-738925, reverse complement, Verified ORF, "Mitochondrial GTPase related to dynamin, present in a complex containing Ugo1p and Fzo1p; required for normal morphology of cristae and for stability of Tim11p; homolog of human OPA1 involved in autosomal dominant optic atrophy"
Sequence
MNASPVRLLILRRQLATHPAILYSSPYIKSPLVHLHSRMSNVHRSAHANALSFVITRRSI
SHFPKIISKIIRLPIYVGGGMAAAGSYIAYKMEEASSFTKDKLDRIKDLGESMKEKFNKM
FSGDKSQDGGHGNDGTVPTATLIAATSLDDDESKRQGDPKDDDDEDDDDEDDENDSVDTT
QDEMLNLTKQMIEIRTILNKVDSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGS
NMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEP
IQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPNIILAISAADVD
LANSSALKASKAADPKGLRTIGVITKLDLVDPEKARSILNNKKYPLSMGYVGVITKTPSS
INRKHLGLFGEAPSSSLSGIFSKGQHGQSSGEENTNGLKQIVSHQFEKAYFKENKKYFTN
CQVSTKKLREKLIKILEISMSNALEPTSTLIQQELDDTSYLFKVEFNDRHLTPKSYLLNN
IDVLKLGIKEFQEKFHRNELKSILRAELDQKVLDVLATRYWKDDNLQDLSSSKLESDTDM
LYWHKKLELASSGLTKMGIGRLSTMLTTNAILKELDNILESTQLKNHELIKDLVSNTAIN
VLNSKYYSTADQVENCIKPFKYEIDLEERDWSLARQHSINLIKEELRQCNSRYQAIKNAV
GSKKLANVMGYLENESNLQKETLGMSKLLLERGSEAIFLDKRCKVLSFRLKMLKNKCHST
IEKDRCPEVFLSAVSDKLTSTAVLFLNVELLSDFFYNFPIELDRRLTLLGDEQVEMFAKE
DPKISRHIELQKRKELLELALEKIDSILVFKKSYKGVSKNL
Download sequence
Identical sequences P32266
YOR211C YOR211C 4932.YOR211C YOR211C YOR211C YOR211C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]