SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR212W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR212W
Domain Number 1 Region: 52-314,350-419
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.54e-63
Family WD40-repeat 4.52e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YOR212W   Protein: S000005738
Sequence length 423
Comment STE4 SGDID:S000005738, Chr XV from 742911-744182, Verified ORF, "G protein beta subunit, forms a dimer with Ste18p to activate the mating signaling pathway, forms a heterotrimer with Gpa1p and Ste18p to dampen signaling; may recruit Rho1p to the polarized growth site during mating; contains WD40 repeats"
Sequence
MAAHQMDSITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKI
QDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWD
SASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH
TCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSS
NTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLR
SDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSAS
GRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSP
GYQ
Download sequence
Identical sequences A6ZP55 B3LJN6 B5VS95 C7GWH0 C8ZGW7 G2WN84 P18851
YOR212W YOR212W YOR212W YOR212W YOR212W YOR212W YOR212W GO.34681 YOR212W YOR212W YOR212W 4932.YOR212W YOR212W SCRT_01600 YOR212W tr|A6ZP55|A6ZP55_YEAS7 YOR212W YOR212W YOR212W

Jump to [ Top of page · Domain architecture · Domain assignment details ]