SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR212W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR212W
Domain Number 1 Region: 52-314,350-419
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.54e-63
Family WD40-repeat 0.000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR212W   Protein: S000005738
Sequence length 423
Comment STE4 SGDID:S000005738, Chr XV from 742911-744182, Verified ORF, "G protein beta subunit, forms a dimer with Ste18p to activate the mating signaling pathway, forms a heterotrimer with Gpa1p and Ste18p to dampen signaling; may recruit Rho1p to the polarized growth site during mating; contains WD40 repeats"
Sequence
MAAHQMDSITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKI
QDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWD
SASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH
TCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSS
NTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLR
SDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSAS
GRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSP
GYQ
Download sequence
Identical sequences A0A0L8VH44 A0A250WAH8 A6ZP55 B3LJN6 B5VS95 C7GWH0 C8ZGW7 G2WN84 N1NYN2 P18851
tr|A6ZP55|A6ZP55_YEAS7 YOR212W YOR212W NP_014855.3.97178 YOR212W YOR212W YOR212W YOR212W YOR212W YOR212W SCRT_01600 YOR212W YOR212W GO.34681 YOR212W YOR212W 4932.YOR212W YOR212W YOR212W YOR212W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]