SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR224C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR224C
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.65e-50
Family RNA polymerase subunit RBP8 8.95e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YOR224C   Protein: S000005750
Sequence length 146
Comment RPB8 SGDID:S000005750, Chr XV from 761266-760826, reverse complement, Verified ORF, "RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III"
Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR
Download sequence
Identical sequences A6ZP66 B3LJP7 C7GWF9 C8ZGX8 E7KI92 E7KUQ2 E7M0K4 E7NMS0 E7Q9B6 E7QKW5 G2WN95 H0GNU0 N1NVW0 P20436 W7PLF9 W7R525
YOR224C 1twfH YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C 4932.YOR224C SCRT_01611 YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C tr|A6ZP66|A6ZP66_YEAS7 1a1d.A 1i3q.H 1i50.H 1i6h.H 1k83.H 1nik.H 1nt9.H 1pqv.H 1r5u.H 1r9r.H 1r9s.H 1r9t.H 1sfo.H 1twa.H 1twc.H 1twf.H 1twg.H 1twh.H 1wcm.H 1y1v.H 1y1w.H 1y1y.H 1y77.H 2b63.H 2b8k.H 2e2h.H 2e2i.H 2e2j.H 2ja5.H 2ja6.H 2ja7.H 2ja7.T 2ja8.H 2nvq.H 2nvs.H 2nvt.H 2nvx.H 2nvy.H 2nvz.H 2r7z.H 2r92.H 2r93.H 2vum.H 2yu9.H 3cqz.H 3fki.H 3gtg.H 3gtj.H 3gtk.H 3gtl.H 3gtm.H 3gto.H 3gtp.H 3gtq.H 3h3v.I 3hou.H 3hou.T 3hov.H 3how.H 3hox.H 3hoy.H 3hoz.H 3i4m.H 3i4n.H 3j0k.H 3j1n.H 3k1f.H 3k7a.H 3m3y.H 3m4o.H 3po2.H 3po3.H 3qt1.H 3rzd.H 3rzo.H 3s14.H 3s15.H 3s16.H 3s17.H 3s1m.H 3s1n.H 3s1q.H 3s1r.H 3s2d.H 3s2h.H 4a3b.H 4a3c.H 4a3d.H 4a3e.H 4a3f.H 4a3g.H 4a3i.H 4a3j.H 4a3k.H 4a3l.H 4a3m.H 4a93.H 4bbr.H 4bbs.H YOR224C YOR224C YOR224c___KOG3400 YOR224C

Jump to [ Top of page · Domain architecture · Domain assignment details ]