SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR224C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR224C
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.65e-50
Family RNA polymerase subunit RBP8 0.0000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.127 52.82
replication fork 2.242 37.57
protein-DNA complex 2.242 33.98
chromosomal region 1.935 31.1
nuclear chromosome 1.727 23.98
chromosomal part 1.471 22.3
ribosomal subunit 1.948 22.06
intracellular ribonucleoprotein complex 1.323 19.98
nucleoplasm part 1.424 12.33
cytosolic ribosome 2.062 9.5

Protein sequence

External link(s) Locus: YOR224C   Protein: S000005750
Sequence length 146
Comment RPB8 SGDID:S000005750, Chr XV from 761266-760826, reverse complement, Verified ORF, "RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III"
Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR
Download sequence
Identical sequences A6ZP66 B3LJP7 C7GWF9 C8ZGX8 E7KI92 E7KUQ2 E7M0K4 E7NMS0 E7Q9B6 E7QKW5 G2WN95 H0GNU0 N1NVW0 P20436 W7PLF9 W7R525
YOR224C YOR224C YOR224C YOR224C YOR224C 4932.YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C 1twfH tr|A6ZP66|A6ZP66_YEAS7 YOR224C YOR224C YOR224C YOR224C 1a1d.A 1i3q.H 1i50.H 1i6h.H 1k83.H 1nik.H 1nt9.H 1pqv.H 1r5u.H 1r9r.H 1r9s.H 1r9t.H 1sfo.H 1twa.H 1twc.H 1twf.H 1twg.H 1twh.H 1wcm.H 1y1v.H 1y1w.H 1y1y.H 1y77.H 2b63.H 2b8k.H 2e2h.H 2e2i.H 2e2j.H 2ja5.H 2ja6.H 2ja7.H 2ja7.T 2ja8.H 2nvq.H 2nvs.H 2nvt.H 2nvx.H 2nvy.H 2nvz.H 2r7z.H 2r92.H 2r93.H 2vum.H 2yu9.H 3cqz.H 3fki.H 3gtg.H 3gtj.H 3gtk.H 3gtl.H 3gtm.H 3gto.H 3gtp.H 3gtq.H 3h3v.I 3hou.H 3hou.T 3hov.H 3how.H 3hox.H 3hoy.H 3hoz.H 3i4m.H 3i4n.H 3j0k.H 3j1n.H 3k1f.H 3k7a.H 3m3y.H 3m4o.H 3po2.H 3po3.H 3qt1.H 3rzd.H 3rzo.H 3s14.H 3s15.H 3s16.H 3s17.H 3s1m.H 3s1n.H 3s1q.H 3s1r.H 3s2d.H 3s2h.H 4a3b.H 4a3c.H 4a3d.H 4a3e.H 4a3f.H 4a3g.H 4a3i.H 4a3j.H 4a3k.H 4a3l.H 4a3m.H 4a93.H 4bbr.H 4bbs.H 4bxx.H 4bxz.H 4by1.H 4c2m.H 4c2m.W 4c3h.H 4c3i.H 4c3j.H SCRT_01611 YOR224C YOR224C YOR224C YOR224C YOR224C YOR224c___KOG3400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]