SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR224C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR224C
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.65e-50
Family RNA polymerase subunit RBP8 0.0000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.182 53.06
replication fork 2.213 37.25
nucleoplasm part 1.369 33.64
chromosomal region 1.996 30.26
protein-DNA complex 1.923 25.92
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
nuclear chromosome part 1.842 24
ribosomal subunit 1.983 22.4
chromosomal part 1.512 22.28
intracellular ribonucleoprotein complex 1.368 20.13

Protein sequence

External link(s) Locus: YOR224C   Protein: S000005750
Sequence length 146
Comment RPB8 SGDID:S000005750, Chr XV from 761266-760826, reverse complement, Verified ORF, "RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III"
Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR
Download sequence
Identical sequences A0A0L8VH36 A6ZP66 B3LJP7 C7GWF9 C8ZGX8 E7KI92 E7KUQ2 E7M0K4 E7NMS0 E7Q9B6 E7QKW5 G2WN95 H0GNU0 N1NVW0 P20436
YOR224C YOR224C YOR224C YOR224c___KOG3400 YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C 000133931|e3fkiH1|2.1.1.49|H:1-146 000148901|e4a93H1|2.1.1.49|H:1-146 000364976|e3gtgH1|2.1.1.49|H:1-146 000364994|e3gtjH1|2.1.1.49|H:1-146 000365021|e3gtkH1|2.1.1.49|H:1-146 000368678|e3hoxH1|2.1.1.49|H:1-146 000368720|e3hozH1|2.1.1.49|H:1-146 000372210|e3i4mH1|2.1.1.49|H:1-146 000372231|e3i4nH1|2.1.1.49|H:1-146 001681185|e5c3eH1|2.1.1.49|H:1-146 001681216|e5c44H1|2.1.1.49|H:1-146 001681246|e5c4aH1|2.1.1.49|H:1-146 001681307|e5c4xH1|2.1.1.49|H:1-146 001715094|e5fj8H1|2.1.1.49|H:1-146 001715119|e5fj9H1|2.1.1.49|H:1-146 001715141|e5fjaH1|2.1.1.49|H:1-146 cath|current|1i3qH00/2-146 cath|current|1i50H00/2-146 cath|current|1i6hH00/2-146 cath|current|1k83H00/2-146 cath|current|1r9rH00/2-146 cath|current|1r9tH00/2-146 cath|current|1sfoH00/2-146 cath|current|1twaH00/2-146 cath|current|1twcH00/2-146 cath|current|1twfH00/2-146 cath|current|1twgH00/2-146 cath|current|1twhH00/2-146 cath|current|1wcmH00/2-146 cath|current|1y1vH00/2-146 cath|current|1y1wH00/2-146 cath|current|2b63H00/2-146 cath|current|2e2hH00/2-146 cath|current|2e2iH00/1-146 cath|current|2e2jH00/2-146 cath|current|2ja5H00/2-146 cath|current|2ja6H00/2-146 cath|current|2ja7H00/2-146 cath|current|2ja7T00/2-146 cath|current|2ja8H00/2-146 cath|current|2nvqH00/2-146 cath|current|2nvsH00/2-146 cath|current|2nvtH00/2-146 cath|current|2nvxH00/1-146 cath|current|2nvyH00/2-146 cath|current|2r7zH00/2-146 cath|current|2r92H00/2-146 cath|current|2r93H00/2-146 cath|current|2vumH00/2-146 cath|current|2yu9H00/2-146 cath|current|3cqzH00/2-146 cath|current|3fkiH00/1-146 cath|current|3gtgH00/1-146 cath|current|3gtjH00/1-146 cath|current|3gtkH00/1-146 cath|current|3gtlH00/2-146 cath|current|3gtmH00/2-146 cath|current|3gtoH00/2-146 cath|current|3gtpH00/2-146 cath|current|3gtqH00/2-146 cath|current|3h3vI00/2-146 cath|current|3houH00/2-146 cath|current|3houT00/2-146 cath|current|3hovH00/2-146 cath|current|3howH00/2-146 cath|current|3hoxH00/1-146 cath|current|3hoyH00/2-146 cath|current|3hozH00/1-146 cath|current|3i4mH00/1-146 cath|current|3i4nH00/1-146 cath|current|3k7aH00/2-146 cath|current|3m3yH00/2-146 cath|current|3m4oH00/2-146 cath|current|3po2H00/2-146 cath|current|3po3H00/2-146 cath|current|3rzdH00/2-146 cath|current|3rzoH00/2-146 cath|current|3s14H00/2-146 cath|current|3s15H00/2-146 cath|current|3s16H00/2-146 cath|current|3s17H00/2-146 cath|current|3s1mH00/2-146 cath|current|3s1nH00/2-146 cath|current|3s1qH00/2-146 cath|current|3s1rH00/2-146 cath|current|3s2dH00/2-146 cath|current|3s2hH00/2-146 cath|current|4a3bH00/2-146 cath|current|4a3cH00/2-146 cath|current|4a3dH00/2-146 cath|current|4a3eH00/2-146 cath|current|4a3fH00/2-146 cath|current|4a3gH00/2-146 cath|current|4a3iH00/2-146 cath|current|4a3jH00/2-146 cath|current|4a3kH00/2-146 cath|current|4a3lH00/2-146 cath|current|4a3mH00/2-146 cath|current|4a93H00/2-146 cath|current|4bbrH00/2-146 cath|current|4bbsH00/2-146 cath|current|4bxxH00/2-146 cath|current|4by1H00/2-146 cath|current|4c2mH00/3-146 cath|current|4c2mW00/3-146 cath|current|4c3hH00/3-146 cath|current|4c3iH00/3-146 cath|current|4c3jH00/3-146 d1a1da_ YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C YOR224C tr|A6ZP66|A6ZP66_YEAS7 YOR224C YOR224C 1a1d.A 1i3q.H 1i50.H 1i6h.H 1k83.H 1nik.H 1nt9.H 1pqv.H 1r5u.H 1r9s.H 1r9t.H 1sfo.H 1twa.H 1twc.H 1twf.H 1twg.H 1twh.H 1wcm.H 1y1v.H 1y1w.H 1y1y.H 1y77.H 2b63.H 2b8k.H 2e2h.H 2e2i.H 2e2j.H 2ja5.H 2ja6.H 2ja7.H 2ja7.T 2ja8.H 2nvq.H 2nvt.H 2nvx.H 2nvy.H 2nvz.H 2r7z.H 2r92.H 2r93.H 2vum.H 2yu9.H 3cqz.H 3fki.H 3gtg.H 3gtj.H 3gtk.H 3gtl.H 3gtm.H 3gto.H 3gtp.H 3gtq.H 3h3v.I 3hou.H 3hou.T 3hov.H 3how.H 3hox.H 3hoy.H 3hoz.H 3i4m.H 3i4n.H 3j0k.H 3j1n.H 3k1f.H 3k7a.H 3m3y.H 3m4o.H 3po2.H 3po3.H 3qt1.H 3rzd.H 3rzo.H 3s14.H 3s15.H 3s16.H 3s17.H 3s1m.H 3s1n.H 3s1q.H 3s1r.H 3s2d.H 3s2h.H 4a3b.H 4a3c.H 4a3d.H 4a3e.H 4a3f.H 4a3g.H 4a3i.H 4a3j.H 4a3k.H 4a3l.H 4a3m.H 4a93.H 4bbr.H 4bbs.H 4bxx.H 4bxz.H 4by1.H 4c2m.H 4c2m.W 4c3h.H 4c3i.H 4c3j.H 4v1m.H 4v1n.H 4v1o.H 4x67.H 4x6a.H 4y52.H 4y7n.H 4ym7.AH 4ym7.BH 4ym7.CH 4ym7.DH 4ym7.EH 4ym7.FH 5c3e.H 5c44.H 5c4a.H 5c4j.H 5c4x.H 5fj8.H 5fj9.H 5fja.H 5fmf.H 5fyw.H 5fz5.H 5g5l.H 5lmx.H 5m3f.H 5m3m.H 5m5w.H 5m5x.H 5m5y.H 5m64.H 5n5y.H 5n5z.H 5n60.H 5n61.H 5sva.H 5u5q.H YOR224C YOR224C SCRT_01611 YOR224C 4932.YOR224C YOR224C YOR224C 1twfH YOR224C YOR224C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]