SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR231C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR231C-A   Protein: S000028716
Sequence length 66
Comment YOR231C-A SGDID:S000028716, Chr XV from 773364-773164, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPIDQHLVHCLSLC
TIQKMI
Download sequence
Identical sequences C8ZGY5 Q8TGL2
YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A 4932.YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]