SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOR231C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR231C-A   Protein: S000028716
Sequence length 66
Comment YOR231C-A SGDID:S000028716, Chr XV from 773364-773164, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPIDQHLVHCLSLC
TIQKMI
Download sequence
Identical sequences C8ZGY5 Q8TGL2
YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A 4932.YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A YOR231C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]