SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR231W
Domain Number 1 Region: 217-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-78
Family Protein kinases, catalytic subunit 2.45e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YOR231W   Protein: S000005757
Sequence length 508
Comment MKK1 SGDID:S000005757, Chr XV from 772602-774128, Verified ORF, "Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p"
Sequence
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTS
TLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLG
LKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSS
PIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKL
KNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAME
YMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNEN
GQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKF
PCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPR
QMINHPWIKGQMKKNVNMEKFVRKCWKD
Download sequence
Identical sequences A6ZP72 B3LJQ3 C8ZGY4 E7KUJ0 H0GNU5 N1P3H6 P32490 W7PA13
YOR231W YOR231W 4932.YOR231W YOR231W YOR231W SCRT_01617 YOR231W YOR231W tr|A6ZP72|A6ZP72_YEAS7 YOR231W YOR231W YOR231W YOR231W

Jump to [ Top of page · Domain architecture · Domain assignment details ]