SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR231W
Domain Number 1 Region: 217-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-78
Family Protein kinases, catalytic subunit 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plasma membrane receptor complex 1.824 13.31
spindle 1.815 12.85
cytosol 1.295 12.48
chromosomal part 1.512 9.33
synapse part 1.419 8.28
midbody 2.182 8.19
cell division site 2.125 8.13
nuclear chromosome part 1.842 8.05
site of polarized growth 1.648 7.71
cytoplasmic region 1.567 7.39
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.662 87.19
growth factor binding 1.592 45.46
ATP binding 1.433 38.77
lyase activity 1.408 25.05
cytokine binding 1.952 24.28
calmodulin binding 2.02 18.7
magnesium ion binding 1.87 15.88
double-stranded DNA binding 1.546 15.2
protein domain specific binding 1.452 12.79
enzyme activator activity 1.431 10.25

Protein sequence

External link(s) Locus: YOR231W   Protein: S000005757
Sequence length 508
Comment MKK1 SGDID:S000005757, Chr XV from 772602-774128, Verified ORF, "Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p"
Sequence
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTS
TLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLG
LKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSS
PIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKL
KNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAME
YMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNEN
GQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKF
PCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPR
QMINHPWIKGQMKKNVNMEKFVRKCWKD
Download sequence
Identical sequences A0A0L8VH20 A6ZP72 B3LJQ3 C8ZGY4 E7KUJ0 H0GNU5 N1P3H6 P32490
YOR231W YOR231W YOR231W YOR231W YOR231W SCRT_01617 YOR231W YOR231W 4932.YOR231W YOR231W tr|A6ZP72|A6ZP72_YEAS7 YOR231W YOR231W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]