SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR231W
Domain Number 1 Region: 217-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-78
Family Protein kinases, catalytic subunit 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.648 86.61
growth factor binding 1.611 44.21
ATP binding 1.435 39.05
lyase activity 1.395 24.82
cytokine binding 1.999 23.38
phosphatidylinositol 3-kinase binding 2.24 19.88
calmodulin binding 2.015 19.14
magnesium ion binding 1.85 16.51
double-stranded DNA binding 1.549 15.32
protein domain specific binding 1.443 12.75
Cellular Component IC (bits) H-Score
plasma membrane receptor complex 1.776 12.75
cytosolic part 1.704 8.74
chromosomal part 1.456 8.58
midbody 2.192 8.39
site of polarized growth 1.678 8.23
cytoplasmic region 1.531 7.92
cell division site 2.082 7.9
nuclear chromosome part 1.803 7.62
presynapse 1.715 7.39
axon 1.493 7.39

Protein sequence

External link(s) Locus: YOR231W   Protein: S000005757
Sequence length 508
Comment MKK1 SGDID:S000005757, Chr XV from 772602-774128, Verified ORF, "Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p"
Sequence
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTS
TLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLG
LKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSS
PIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKL
KNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAME
YMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNEN
GQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKF
PCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPR
QMINHPWIKGQMKKNVNMEKFVRKCWKD
Download sequence
Identical sequences A6ZP72 B3LJQ3 C8ZGY4 E7KUJ0 H0GNU5 N1P3H6 P32490 W7PA13
YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W 4932.YOR231W YOR231W YOR231W SCRT_01617 YOR231W YOR231W tr|A6ZP72|A6ZP72_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]