SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR231W
Domain Number 1 Region: 217-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-78
Family Protein kinases, catalytic subunit 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex, transferring phosphorus-containing groups 1.653 20.41
centrosome 1.852 15.05
spindle 1.756 12.66
integral component of plasma membrane 1.37 12.19
plasma membrane receptor complex 1.761 12.19
microtubule associated complex 2.062 9.54
chromosomal part 1.471 8.57
cytoplasmic region 1.533 8.36
cell division site 2.089 8.19
midbody 2.148 8
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.668 85.69
growth factor binding 1.647 44.44
ATP binding 1.507 39.95
lyase activity 1.42 25
cytokine binding 2.018 23.74
calmodulin binding 2.043 19.32
magnesium ion binding 1.858 16.86
structure-specific DNA binding 2.206 15.3
protein domain specific binding 1.437 12.42
enzyme activator activity 1.476 10.49

Protein sequence

External link(s) Locus: YOR231W   Protein: S000005757
Sequence length 508
Comment MKK1 SGDID:S000005757, Chr XV from 772602-774128, Verified ORF, "Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p"
Sequence
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTS
TLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLG
LKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSS
PIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKL
KNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAME
YMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNEN
GQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKF
PCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPR
QMINHPWIKGQMKKNVNMEKFVRKCWKD
Download sequence
Identical sequences A6ZP72 B3LJQ3 C8ZGY4 E7KUJ0 H0GNU5 N1P3H6 P32490 W7PA13
4932.YOR231W SCRT_01617 tr|A6ZP72|A6ZP72_YEAS7 YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W YOR231W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]