SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR232W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR232W
Domain Number 1 Region: 66-168
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 3.27e-24
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0013
Further Details:      
 
Domain Number 2 Region: 169-226
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 4.18e-18
Family Head domain of nucleotide exchange factor GrpE 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
protein localization to mitochondrion 2.227 35.07
mitochondrial transport 1.901 24.58
transmembrane transport 1.482 19.52
protein targeting 1.508 12.46
protein localization to organelle 1.46 12.35
cytoplasmic transport 1.31 10.31
mitochondrion organization 1.548 6.27
Cellular Component IC (bits) H-Score
mitochondrial envelope 1.573 9.7
organelle inner membrane 1.669 6.22
mitochondrial matrix 1.714 4.94
Molecular Function IC (bits) H-Score
unfolded protein binding 2.182 32.02
copper ion binding 2.103 16.75

Protein sequence

External link(s) Locus: YOR232W   Protein: S000005758
Sequence length 228
Comment MGE1 SGDID:S000005758, Chr XV from 774574-775260, Verified ORF, "Protein of the mitochondrial matrix involved in protein import into mitochondria; acts as a cochaperone and a nucleotide release factor for Ssc1p; homolog of E. coli GrpE"
Sequence
MRAFSAATVRATTRKSFIPMAPRTPFVTPSFTKNVGSMRRMRFYSDEAKSEESKENNEDL
TEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQKAKDFALQKFAKD
LLESVDNFGHALNAFKEEDLQKSKEISDLYTGVRMTRDVFENTLRKHGIEKLDPLGEPFD
PNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVKGEEN
Download sequence
Identical sequences A6ZP73 B3LJQ4 B5VSB3 E7QKX0 N1NYQ1 P38523 W7R529
tr|A6ZP73|A6ZP73_YEAS7 YOR232W MGE1_YEAST YOR232W YOR232W YOR232W YOR232W YOR232W YOR232W YOR232W SCRT_01618 4932.YOR232W YOR232W YOR232W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]