SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR232W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR232W
Domain Number 1 Region: 66-168
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 3.27e-24
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0013
Further Details:      
 
Domain Number 2 Region: 169-226
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 4.18e-18
Family Head domain of nucleotide exchange factor GrpE 0.0015
Further Details:      
 

Protein sequence

External link(s) Locus: YOR232W   Protein: S000005758
Sequence length 228
Comment MGE1 SGDID:S000005758, Chr XV from 774574-775260, Verified ORF, "Protein of the mitochondrial matrix involved in protein import into mitochondria; acts as a cochaperone and a nucleotide release factor for Ssc1p; homolog of E. coli GrpE"
Sequence
MRAFSAATVRATTRKSFIPMAPRTPFVTPSFTKNVGSMRRMRFYSDEAKSEESKENNEDL
TEEQSEIKKLESQLSAKTKEASELKDRLLRSVADFRNLQQVTKKDIQKAKDFALQKFAKD
LLESVDNFGHALNAFKEEDLQKSKEISDLYTGVRMTRDVFENTLRKHGIEKLDPLGEPFD
PNKHEATFELPQPDKEPGTVFHVQQLGFTLNDRVIRPAKVGIVKGEEN
Download sequence
Identical sequences A6ZP73 B3LJQ4 B5VSB3 E7QKX0 N1NYQ1 P38523 W7R529
YOR232W YOR232W 4932.YOR232W YOR232W YOR232W SCRT_01618 YOR232W YOR232W YOR232W tr|A6ZP73|A6ZP73_YEAS7 YOR232W YOR232W MGE1_YEAST YOR232W

Jump to [ Top of page · Domain architecture · Domain assignment details ]