SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR235W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR235W   Protein: S000005761
Sequence length 104
Comment IRC13 SGDID:S000005761, Chr XV from 779871-780185, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; null mutant displays increased levels of spontaneous Rad52 foci"
Sequence
MGLYRPSKFFHPPIPHIPFTINPDFFSFHIQRLKAKANPENFLICFPPPDIYKGFVFCCQ
LDLVHLFSYVFFLFLLKICVDVLQYVIYPKHFTHKKPGFENYSI
Download sequence
Identical sequences Q08630
YOR235W YOR235W 4932.YOR235W YOR235W YOR235W YOR235W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]