SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR235W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR235W   Protein: S000005761
Sequence length 104
Comment IRC13 SGDID:S000005761, Chr XV from 779871-780185, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; null mutant displays increased levels of spontaneous Rad52 foci"
Sequence
MGLYRPSKFFHPPIPHIPFTINPDFFSFHIQRLKAKANPENFLICFPPPDIYKGFVFCCQ
LDLVHLFSYVFFLFLLKICVDVLQYVIYPKHFTHKKPGFENYSI
Download sequence
Identical sequences Q08630
YOR235W YOR235W 4932.YOR235W YOR235W YOR235W YOR235W

Jump to [ Top of page · Domain architecture · Domain assignment details ]