SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR269W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR269W
Domain Number 1 Region: 142-489
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.3e-50
Family WD40-repeat 0.0000223
Further Details:      
 
Domain Number 2 Region: 10-45,73-109
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 3.4e-18
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YOR269W   Protein: S000005795
Sequence length 494
Comment PAC1 SGDID:S000005795, Chr XV from 826384-827868, Verified ORF, "Protein involved in nuclear migration, part of the dynein/dynactin pathway; targets dynein to microtubule tips, which is necessary for sliding of microtubules along bud cortex; synthetic lethal with bni1; homolog of human LIS1"
Sequence
MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRHEHAQDYESVRHAIVTLSGFLLQES
VDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKIIELEQNTETLVSQIKDLNTQV
SELAQFKPTTSNGTSAHNVLKWIPRNLPSCLINVESSVTSVKLHPNLPIVFVATDHGKLY
AFDLFNYTIPLASLQSHTKAITSMDVLFTNYTNSSKKNYLVIVTASKDLQIHVFKWVSEE
CKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWV
RSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTP
STDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWV
RDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDLDVDFDSNVTPRQMM
VTGGLDCKSNVFMR
Download sequence
Identical sequences A6ZPA6 N1NYT2 P39946
YOR269W tr|A6ZPA6|A6ZPA6_YEAS7 YOR269W YOR269W YOR269W YOR269W 4932.YOR269W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]