SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR269W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR269W
Domain Number 1 Region: 142-489
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.3e-50
Family WD40-repeat 2.23e-05
Further Details:      
 
Domain Number 2 Region: 10-45,73-109
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 3.4e-18
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.003
Further Details:      
 

Protein sequence

External link(s) Locus: YOR269W   Protein: S000005795
Sequence length 494
Comment PAC1 SGDID:S000005795, Chr XV from 826384-827868, Verified ORF, "Protein involved in nuclear migration, part of the dynein/dynactin pathway; targets dynein to microtubule tips, which is necessary for sliding of microtubules along bud cortex; synthetic lethal with bni1; homolog of human LIS1"
Sequence
MTNWQQQLPLTDTQKNELDKSVLRYLNWNYKQTVRHEHAQDYESVRHAIVTLSGFLLQES
VDRQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKIIELEQNTETLVSQIKDLNTQV
SELAQFKPTTSNGTSAHNVLKWIPRNLPSCLINVESSVTSVKLHPNLPIVFVATDHGKLY
AFDLFNYTIPLASLQSHTKAITSMDVLFTNYTNSSKKNYLVIVTASKDLQIHVFKWVSEE
CKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWV
RSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTP
STDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWV
RDISIRGQYLFSCADDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDLDVDFDSNVTPRQMM
VTGGLDCKSNVFMR
Download sequence
Identical sequences A6ZPA6 P39946
YOR269W YOR269W 4932.YOR269W YOR269W YOR269W YOR269W tr|A6ZPA6|A6ZPA6_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]