SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR293C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR293C-A   Protein: S000028858
Sequence length 49
Comment YOR293C-A SGDID:S000028858, Chr XV from 868146-867997, reverse complement, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry"
Sequence
MKLLFLNIIVVRRHLHCKSYRLSPWYIYIYGDYLLYTTEIPYKPFTRQP
Download sequence
Identical sequences B3LJV8 Q3E7Y7
YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A SCRT_01674 YOR293C-A 4932.YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]