SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR293C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR293C-A   Protein: S000028858
Sequence length 49
Comment YOR293C-A SGDID:S000028858, Chr XV from 868146-867997, reverse complement, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry"
Sequence
MKLLFLNIIVVRRHLHCKSYRLSPWYIYIYGDYLLYTTEIPYKPFTRQP
Download sequence
Identical sequences B3LJV8 Q3E7Y7
YOR293C-A YOR293C-A 4932.YOR293C-A YOR293C-A YOR293C-A SCRT_01674 YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]