SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR293C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR293C-A   Protein: S000028858
Sequence length 49
Comment YOR293C-A SGDID:S000028858, Chr XV from 868146-867997, reverse complement, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry"
Sequence
MKLLFLNIIVVRRHLHCKSYRLSPWYIYIYGDYLLYTTEIPYKPFTRQP
Download sequence
Identical sequences B3LJV8 Q3E7Y7
YOR293C-A YOR293C-A SCRT_01674 4932.YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A YOR293C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]