SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR329W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR329W-A   Protein: S000028585
Sequence length 69
Comment YOR329W-A SGDID:S000028585, Chr XV from 939345-939554, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by fungal homology and RT-PCR"
Sequence
MFRYHVKFIEPAMIYKILANEKMQIIWVLNSYFEFYLLFCPRFLMLTLFLIGATYFCFLI
WRKKVSRNK
Download sequence
Identical sequences C8ZH81 P0C5R1 W7PA79
YOR329W-A 4932.YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]