SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR329W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YOR329W-A   Protein: S000028585
Sequence length 69
Comment YOR329W-A SGDID:S000028585, Chr XV from 939345-939554, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by fungal homology and RT-PCR"
Sequence
MFRYHVKFIEPAMIYKILANEKMQIIWVLNSYFEFYLLFCPRFLMLTLFLIGATYFCFLI
WRKKVSRNK
Download sequence
Identical sequences C8ZH81 P0C5R1
YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A 4932.YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A YOR329W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]