SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR357C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR357C
Domain Number 1 Region: 31-158
Classification Level Classification E-value
Superfamily PX domain 6.28e-38
Family PX domain 1.64e-07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endosome 1.325 41.25
endosome membrane 1.968 39.94
integral to plasma membrane 1.469 36.67
cell projection membrane 1.528 9.33
microtubule associated complex 1.999 8.83
microtubule cytoskeleton 1.334 8.83
internal side of plasma membrane 2.099 6.28
extrinsic to plasma membrane 1.992 4.56
brush border 1.481 4.29
vacuole 1.428 3.82

Protein sequence

External link(s) Locus: YOR357C   Protein: S000005884
Sequence length 162
Comment SNX3 SGDID:S000005884, Chr XV from 1009710-1009222, reverse complement, Verified ORF, "Sorting nexin required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment; contains a PX domain and sequence similarity to human Snx3p"
Sequence
MPREFKSFGSTEKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDY
EIICRTNLPSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFS
NEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEKFVG
Download sequence
Identical sequences A6ZPI7 B3LK14 B5VSN5 C7GNR1 C8ZHA7 E7KIM4 E7KUS8 E7M0U5 E7NMW0 E7QL48 G2WNL8 N1NXJ1 Q08826 W7PLT4 W7QVN4
YOR357C 1ocsA YOR357C YOR357C YOR357C YOR357C YOR357C YOR357c YOR357C YOR357C YOR357C YOR357C 4932.YOR357C SCRT_01732 YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C YOR357C tr|A6ZPI7|A6ZPI7_YEAS7 1ocs.A 1ocu.A 1ocu.B YOR357C YOR357C YOR357C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]