SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR374W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR374W
Domain Number 1 Region: 34-514
Classification Level Classification E-value
Superfamily ALDH-like 1.1e-173
Family ALDH-like 4.97e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YOR374W   Protein: S000005901
Sequence length 519
Comment ALD4 SGDID:S000005901, Chr XV from 1039838-1041397, Verified ORF, "Mitochondrial aldehyde dehydrogenase, required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed"
Sequence
MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFINNKFVPSKQNK
TFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSWNGIDPIDRGKALYRLAELIE
QDKDVIASIETLDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQ
PLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGV
INIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF
ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDES
TFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKE
EIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYND
FHHAVPFGGFNASGLGREMSVDALQNYLQVKAVRAKLDE
Download sequence
Identical sequences A6ZPK2 C8ZHC2 G2WNN4 P46367
YOR374W 4932.YOR374W YOR374W YOR374W YOR374W YOR374W tr|A6ZPK2|A6ZPK2_YEAS7 YOR374W YOR374W YOR374W YOR374W YOR374W

Jump to [ Top of page · Domain architecture · Domain assignment details ]