SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOR374W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR374W
Domain Number 1 Region: 34-514
Classification Level Classification E-value
Superfamily ALDH-like 1.1e-173
Family ALDH-like 0.000000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
lipid particle 1.469 7.54
mitochondrial matrix 1.714 4.79

Protein sequence

External link(s) Locus: YOR374W   Protein: S000005901
Sequence length 519
Comment ALD4 SGDID:S000005901, Chr XV from 1039838-1041397, Verified ORF, "Mitochondrial aldehyde dehydrogenase, required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed"
Sequence
MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFINNKFVPSKQNK
TFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSWNGIDPIDRGKALYRLAELIE
QDKDVIASIETLDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTGRTHFSYTKRQ
PLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGV
INIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF
ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDES
TFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKE
EIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYND
FHHAVPFGGFNASGLGREMSVDALQNYLQVKAVRAKLDE
Download sequence
Identical sequences A6ZPK2 C8ZHC2 G2WNN4 N1NZ13 P46367 W7PDG8
4932.YOR374W YOR374W YOR374W YOR374W YOR374W YOR374W YOR374W tr|A6ZPK2|A6ZPK2_YEAS7 YOR374W YOR374W YOR374W YOR374W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]