SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL011C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPL011C
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily Histone-fold 0.0178
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Protein sequence

External link(s) Locus: YPL011C   Protein: S000005932
Sequence length 353
Comment TAF3 SGDID:S000005932, Chr XVI from 534700-533639, reverse complement, Verified ORF, "TFIID subunit (47 kDa), involved in promoter binding and RNA polymerase II transcription initiation"
Sequence
MTTNNDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASEVSSIAQARCD
QDDTIALQDITLALENLGIVKPTNVLDVYDENSELSSSRGMEKFKDWCIYSTQLTDARIT
ALPTVELLQSEEKESDPLSAIPDYLNQLLQNKGAKQKLETKNRKTELIEDLINNNGLDDW
IKLVIARQRINMIERASKKESQNVPALPHIAGYKSSILSRHHHTTITNEDRMPSAMTPRD
EDALTEIQENPFVTSKLPIMRKENRLENITLSFEDEELESLGEVEGPNQKSQENNNEESF
KENNKSLTESPHGDDRDISMFQFDSNVDTKWAEQEDMDSTFQRRTSLDYGGYF
Download sequence
Identical sequences Q12297
YPL011C YPL011C 4932.YPL011C YPL011C Pf-sce:YPL011C YPL011C YPL011C

Jump to [ Top of page · Domain architecture · Domain assignment details ]