SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL011C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPL011C
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily Histone-fold 0.0178
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL011C   Protein: S000005932
Sequence length 353
Comment TAF3 SGDID:S000005932, Chr XVI from 534700-533639, reverse complement, Verified ORF, "TFIID subunit (47 kDa), involved in promoter binding and RNA polymerase II transcription initiation"
Sequence
MTTNNDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASEVSSIAQARCD
QDDTIALQDITLALENLGIVKPTNVLDVYDENSELSSSRGMEKFKDWCIYSTQLTDARIT
ALPTVELLQSEEKESDPLSAIPDYLNQLLQNKGAKQKLETKNRKTELIEDLINNNGLDDW
IKLVIARQRINMIERASKKESQNVPALPHIAGYKSSILSRHHHTTITNEDRMPSAMTPRD
EDALTEIQENPFVTSKLPIMRKENRLENITLSFEDEELESLGEVEGPNQKSQENNNEESF
KENNKSLTESPHGDDRDISMFQFDSNVDTKWAEQEDMDSTFQRRTSLDYGGYF
Download sequence
Identical sequences N1NXD9 Q12297
YPL011C Pf-sce:YPL011C 4932.YPL011C YPL011C YPL011C YPL011C YPL011C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]