SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL050C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL050C
Domain Number 1 Region: 213-292,320-394
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000114
Family Molybdenum cofactor biosynthesis protein MobA 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL050C   Protein: S000005971
Sequence length 395
Comment MNN9 SGDID:S000005971, Chr XVI from 461963-460776, reverse complement, Verified ORF, "Subunit of Golgi mannosyltransferase complex also containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that mediates elongation of the polysaccharide mannan backbone; forms a separate complex with Van1p that is also involved in backbone elongation"
Sequence
MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLGLNGQSISQHKWAHEKENTF
YFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILIL
TPMQTFHQQYWDNLLQLNYPRELIELGFITPRTATGDLALKKLENAIKKVQTDKKTQRFS
KITILRQNSQSFDKLMEKERHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADII
ETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDD
EIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFY
HLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH
Download sequence
Identical sequences B3LL17 C8ZIX9 E7M1I1 E7QLG7 H0GPQ6 P39107
YPL050C YPL050C YPL050C YPL050C YPL050C NP_015275.1.97178 YPL050C 4932.YPL050C SCRT_02442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]