SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL061W
Domain Number 1 Region: 16-499
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-164
Family ALDH-like 1.55e-09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
lipid particle 1.526 5.27
mitochondrial matrix 1.707 4.78

Protein sequence

External link(s) Locus: YPL061W   Protein: S000005982
Sequence length 500
Comment ALD6 SGDID:S000005982, Chr XVI from 432585-434087, Verified ORF, "Cytosolic aldehyde dehydrogenase, activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for conversion of acetaldehyde to acetate; constitutively expressed; locates to the mitochondrial outer surface upon oxidative stress"
Sequence
MTKLHFDTAEPVKITLPNGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSA
TTEDVEYAIECADRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLA
LARGDVTIAINCLRDAAAYADKVNGRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIMMLA
WKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDP
RIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFK
NAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMN
YIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKTLEE
GVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGR
EMGEEVYHAYTEVKAVRIKL
Download sequence
Identical sequences A6ZWI7 C7GTZ5 C8ZIW9 E7KVM9 E7Q9W2 E9P9H2 G2WPB8 H0GPP5 N1NX93 P54115 W7P8T3 W7RCH1
YPL061W YPL061W YPL061W YPL061W YPL061W YPL061W 4932.YPL061W YPL061W YPL061W YPL061W tr|A6ZWI7|A6ZWI7_YEAS7 YPL061W YPL061W YPL061W YPL061W YPL061W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]