SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL100W
Domain Number 1 Region: 121-179,244-377,437-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-17
Family WD40-repeat 0.017
Further Details:      
 

Protein sequence

External link(s) Locus: YPL100W   Protein: S000006021
Sequence length 496
Comment ATG21 SGDID:S000006021, Chr XVI from 361869-363359, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MKVLQFNQDATCCVVAASSHQISIFNCDPFGKCFEIDTKNSKKKTSNNNGSASNSESRNN
EESILITNGSRDRTDAEEEEDNEDNALVTGNILKEGEFVIEMLFSTSLIAIADRGQGLNK
GKKLKIVNTKRKCTICEIVFPHEIVDVVMNRKRMCVLLESDQIFIYDISCMKPLETIDLW
EDHYKRSQANSFSNASNTGTLEGDSANLNRVATNLLANATQKSVNGSNPSVRTRRNSLRS
KIRPRMVLSNDDRSILCFTAYSSPKKNKPNSEALYDVVIYDTLNVTPVNYLNSVHKGNVA
CLAVSHDGKLLATASDKGTIIRVFHTGVDSDYMSSRSLFKEFRRGTRLCNLYQLAFDKSM
TMIGCVGDTDTIHLFKLDDASNSLPGDNSSNGHWNEEEYILASNSNPSMGTPKEIPLSKP
RIANYFSKKIKSSIPNQNLSRNFAYITVNESNRSCLGFPDEFPNQVYIASDDGTFSIYSI
PSKPGECVLTKNNKFT
Download sequence
Identical sequences N1NX54 Q02887
YPL100W YPL100W 4932.YPL100W YPL100W 355080 YPL100W YPL100W

Jump to [ Top of page · Domain architecture · Domain assignment details ]