SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL100W
Domain Number 1 Region: 121-179,244-377,437-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-17
Family WD40-repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YPL100W   Protein: S000006021
Sequence length 496
Comment ATG21 SGDID:S000006021, Chr XVI from 361869-363359, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MKVLQFNQDATCCVVAASSHQISIFNCDPFGKCFEIDTKNSKKKTSNNNGSASNSESRNN
EESILITNGSRDRTDAEEEEDNEDNALVTGNILKEGEFVIEMLFSTSLIAIADRGQGLNK
GKKLKIVNTKRKCTICEIVFPHEIVDVVMNRKRMCVLLESDQIFIYDISCMKPLETIDLW
EDHYKRSQANSFSNASNTGTLEGDSANLNRVATNLLANATQKSVNGSNPSVRTRRNSLRS
KIRPRMVLSNDDRSILCFTAYSSPKKNKPNSEALYDVVIYDTLNVTPVNYLNSVHKGNVA
CLAVSHDGKLLATASDKGTIIRVFHTGVDSDYMSSRSLFKEFRRGTRLCNLYQLAFDKSM
TMIGCVGDTDTIHLFKLDDASNSLPGDNSSNGHWNEEEYILASNSNPSMGTPKEIPLSKP
RIANYFSKKIKSSIPNQNLSRNFAYITVNESNRSCLGFPDEFPNQVYIASDDGTFSIYSI
PSKPGECVLTKNNKFT
Download sequence
Identical sequences N1NX54 Q02887
YPL100W YPL100W YPL100W YPL100W 4932.YPL100W YPL100W 355080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]