SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPL100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL100W
Domain Number 1 Region: 121-179,244-377,437-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-17
Family WD40-repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37
SWI/SNF superfamily-type complex 2.178 9.97

Protein sequence

External link(s) Locus: YPL100W   Protein: S000006021
Sequence length 496
Comment ATG21 SGDID:S000006021, Chr XVI from 361869-363359, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MKVLQFNQDATCCVVAASSHQISIFNCDPFGKCFEIDTKNSKKKTSNNNGSASNSESRNN
EESILITNGSRDRTDAEEEEDNEDNALVTGNILKEGEFVIEMLFSTSLIAIADRGQGLNK
GKKLKIVNTKRKCTICEIVFPHEIVDVVMNRKRMCVLLESDQIFIYDISCMKPLETIDLW
EDHYKRSQANSFSNASNTGTLEGDSANLNRVATNLLANATQKSVNGSNPSVRTRRNSLRS
KIRPRMVLSNDDRSILCFTAYSSPKKNKPNSEALYDVVIYDTLNVTPVNYLNSVHKGNVA
CLAVSHDGKLLATASDKGTIIRVFHTGVDSDYMSSRSLFKEFRRGTRLCNLYQLAFDKSM
TMIGCVGDTDTIHLFKLDDASNSLPGDNSSNGHWNEEEYILASNSNPSMGTPKEIPLSKP
RIANYFSKKIKSSIPNQNLSRNFAYITVNESNRSCLGFPDEFPNQVYIASDDGTFSIYSI
PSKPGECVLTKNNKFT
Download sequence
Identical sequences N1NX54 Q02887
YPL100W 355080 YPL100W YPL100W YPL100W 4932.YPL100W YPL100W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]