SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL100W
Domain Number 1 Region: 121-179,244-377,437-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-17
Family WD40-repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.688 29.77
kidney development 1.512 26.59
rRNA metabolic process 2.096 23.81
cilium assembly 1.371 22.68
RNA processing 1.496 18.18
microtubule-based movement 2.007 16.81
telomere organization 2.228 16.63
autophagy 2.133 16.23
microtubule-based process 1.533 14.77
sulfur compound metabolic process 1.496 14.2
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.091 51.78
transferase complex 1.334 36.03
methyltransferase complex 2.1 21.1
cilium 1.616 18.76
nuclear transcription factor complex 1.972 13.26
membrane coat 2.031 10.66
vesicle membrane 1.602 9.39
cytoplasmic vesicle part 1.377 9.39
ciliary part 1.785 9.39
DNA-directed RNA polymerase II, holoenzyme 1.966 8.78

Protein sequence

External link(s) Locus: YPL100W   Protein: S000006021
Sequence length 496
Comment ATG21 SGDID:S000006021, Chr XVI from 361869-363359, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MKVLQFNQDATCCVVAASSHQISIFNCDPFGKCFEIDTKNSKKKTSNNNGSASNSESRNN
EESILITNGSRDRTDAEEEEDNEDNALVTGNILKEGEFVIEMLFSTSLIAIADRGQGLNK
GKKLKIVNTKRKCTICEIVFPHEIVDVVMNRKRMCVLLESDQIFIYDISCMKPLETIDLW
EDHYKRSQANSFSNASNTGTLEGDSANLNRVATNLLANATQKSVNGSNPSVRTRRNSLRS
KIRPRMVLSNDDRSILCFTAYSSPKKNKPNSEALYDVVIYDTLNVTPVNYLNSVHKGNVA
CLAVSHDGKLLATASDKGTIIRVFHTGVDSDYMSSRSLFKEFRRGTRLCNLYQLAFDKSM
TMIGCVGDTDTIHLFKLDDASNSLPGDNSSNGHWNEEEYILASNSNPSMGTPKEIPLSKP
RIANYFSKKIKSSIPNQNLSRNFAYITVNESNRSCLGFPDEFPNQVYIASDDGTFSIYSI
PSKPGECVLTKNNKFT
Download sequence
Identical sequences N1NX54 Q02887
YPL100W YPL100W YPL100W YPL100W 355080 4932.YPL100W YPL100W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]