SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL117C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL117C
Domain Number 1 Region: 72-272
Classification Level Classification E-value
Superfamily Nudix 1.97e-41
Family IPP isomerase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 25.16
nuclear body 1.911 25.16
microbody 1.955 11.72
ribonucleoprotein complex 1.415 9.44
ribonucleoprotein granule 1.998 7.99

Protein sequence

External link(s) Locus: YPL117C   Protein: S000006038
Sequence length 288
Comment IDI1 SGDID:S000006038, Chr XVI from 328729-327863, reverse complement, Verified ORF, "Isopentenyl diphosphate:dimethylallyl diphosphate isomerase (IPP isomerase), catalyzes an essential activation step in the isoprenoid biosynthetic pathway; required for viability"
Sequence
MTADNNSMPHGAVSSYAKLVQNQTPEDILEEFPEIIPLQQRPNTRSSETSNDESGETCFS
GHDEEQIKLMNENCIVLDWDDNAIGAGTKKVCHLMENIEKGLLHRAFSVFIFNEQGELLL
QQRATEKITFPDLWTNTCCSHPLCIDDELGLKGKLDDKIKGAITAAVRKLDHELGIPEDE
TKTRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKINAKENLTVNPNVNEVRDFKWVSPN
DLKTMFADPSYKFTPWFKIICENYLFNWWEQLDDLSEVENDRQIHRML
Download sequence
Identical sequences A6ZWD5 B5VT49 C7GJ70 C8ZIR3 E7KVJ0 E7M1D2 E7NNT7 E7QAB5 E7QLC4 G2WP65 H0GPJ9 N1NW25 P15496 W7PRI2 W7R6U4
YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C YPL117C 4932.YPL117C YPL117C YPL117C YPL117C tr|A6ZWD5|A6ZWD5_YEAS7 YPL117C YPL117C YPL117C YPL117c___KOG0142 YPL117C YPL117C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]