SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL126W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL126W
Domain Number 1 Region: 258-328,482-677,739-781
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 7.06e-23
Family Prolyl oligopeptidase, N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 49-124,182-345
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.6e-17
Family WD40-repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
regulation of neurotransmitter transport 2.237 19.65
RNA processing 1.499 17.76
regulation of exocytosis 2.2 16.73
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43

Protein sequence

External link(s) Locus: YPL126W   Protein: S000006047
Sequence length 896
Comment NAN1 SGDID:S000006047, Chr XVI from 310209-312899, Verified ORF, "U3 snoRNP protein, component of the small (ribosomal) subunit (SSU) processosome containing U3 snoRNA; required for the biogenesis of18S rRNA"
Sequence
MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETR
QCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLN
YKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDD
AKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFP
LGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSV
LSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQM
TENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHS
KKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNS
MGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETN
WNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKIS
LPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQ
TVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNI
ALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIE
STLGVVGTTVNTQLSDEVNNEGILDGLVSNTITTSASNSDIFAEQLHKLSSRGKKSDTRD
KNTNDNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT
Download sequence
Identical sequences N1NW22 Q02931
4932.YPL126W YPL126W YPL126W YPL126W YPL126W YPL126W NP_015199.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]