SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL126W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL126W
Domain Number 1 Region: 258-328,482-677,739-781
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 7.06e-23
Family Prolyl oligopeptidase, N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 49-124,182-345
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.6e-17
Family WD40-repeat 0.0066
Further Details:      
 

Protein sequence

External link(s) Locus: YPL126W   Protein: S000006047
Sequence length 896
Comment NAN1 SGDID:S000006047, Chr XVI from 310209-312899, Verified ORF, "U3 snoRNP protein, component of the small (ribosomal) subunit (SSU) processosome containing U3 snoRNA; required for the biogenesis of18S rRNA"
Sequence
MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETR
QCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLN
YKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDD
AKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFP
LGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSV
LSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQM
TENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHS
KKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNS
MGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETN
WNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKIS
LPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQ
TVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNI
ALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIE
STLGVVGTTVNTQLSDEVNNEGILDGLVSNTITTSASNSDIFAEQLHKLSSRGKKSDTRD
KNTNDNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT
Download sequence
Identical sequences N1NW22 Q02931
YPL126W YPL126W 4932.YPL126W YPL126W YPL126W YPL126W

Jump to [ Top of page · Domain architecture · Domain assignment details ]