SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL126W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL126W
Domain Number 1 Region: 258-328,482-677,739-781
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 7.06e-23
Family Prolyl oligopeptidase, N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 49-124,182-345
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.6e-17
Family WD40-repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nuclear membrane 2.218 11.74
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
cytoplasmic vesicle membrane 1.923 10.37
cytoplasmic vesicle part 1.738 10.37

Protein sequence

External link(s) Locus: YPL126W   Protein: S000006047
Sequence length 896
Comment NAN1 SGDID:S000006047, Chr XVI from 310209-312899, Verified ORF, "U3 snoRNP protein, component of the small (ribosomal) subunit (SSU) processosome containing U3 snoRNA; required for the biogenesis of18S rRNA"
Sequence
MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETR
QCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLN
YKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDD
AKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFP
LGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSV
LSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQM
TENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHS
KKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNS
MGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETN
WNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKIS
LPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQ
TVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNI
ALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIE
STLGVVGTTVNTQLSDEVNNEGILDGLVSNTITTSASNSDIFAEQLHKLSSRGKKSDTRD
KNTNDNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT
Download sequence
Identical sequences N1NW22 Q02931
YPL126W YPL126W 4932.YPL126W YPL126W YPL126W YPL126W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]