SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL135C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL135C-A   Protein: S000028720
Sequence length 57
Comment YPL135C-A SGDID:S000028720, Chr XVI from 297850-297677, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MAEPHPKVLNLTSSITPVESLTLICNLITSPHAGAPTRPVPTLGNFLSNEPTFLGCV
Download sequence
Identical sequences C8ZIP5 Q8TGK9
YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A 4932.YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]