SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL135C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPL135C-A   Protein: S000028720
Sequence length 57
Comment YPL135C-A SGDID:S000028720, Chr XVI from 297850-297677, reverse complement, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MAEPHPKVLNLTSSITPVESLTLICNLITSPHAGAPTRPVPTLGNFLSNEPTFLGCV
Download sequence
Identical sequences C8ZIP5 Q8TGK9
YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A 4932.YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A YPL135C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]