SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL151C
Domain Number 1 Region: 124-427
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.8e-72
Family WD40-repeat 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YPL151C   Protein: S000006072
Sequence length 451
Comment PRP46 SGDID:S000006072, Chr XVI from 267534-266179, reverse complement, Verified ORF, "Splicing factor that is found in the Cef1p subcomplex of the spliceosome"
Sequence
MDGNDHKVENLGDVDKFYSRIRWNNQFSYMATLPPHLQSEMEGQKSLLMRYDTYRKESSS
FSGEGKKVTLQHVPTDFSEASQAVISKKDHDTHASAFVNKIFQPEVAEELIVNRYEKLLS
QRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG
HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA
TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT
MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQ
DDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEAD
KSIKIWKQDETATKESEPGLAWNPNLSAKRF
Download sequence
Identical sequences N1NW12 Q12417
4932.YPL151C YPL151C YPL151c___KOG0285 YPL151C YPL151C YPL151C YPL151C YPL151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]