SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPL151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL151C
Domain Number 1 Region: 124-427
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.8e-72
Family WD40-repeat 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YPL151C   Protein: S000006072
Sequence length 451
Comment PRP46 SGDID:S000006072, Chr XVI from 267534-266179, reverse complement, Verified ORF, "Splicing factor that is found in the Cef1p subcomplex of the spliceosome"
Sequence
MDGNDHKVENLGDVDKFYSRIRWNNQFSYMATLPPHLQSEMEGQKSLLMRYDTYRKESSS
FSGEGKKVTLQHVPTDFSEASQAVISKKDHDTHASAFVNKIFQPEVAEELIVNRYEKLLS
QRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG
HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA
TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT
MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQ
DDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEAD
KSIKIWKQDETATKESEPGLAWNPNLSAKRF
Download sequence
Identical sequences N1NW12 Q12417
YPL151c___KOG0285 YPL151C YPL151C YPL151C 4932.YPL151C YPL151C YPL151C YPL151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]