SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL151C
Domain Number 1 Region: 124-427
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.8e-72
Family WD40-repeat 3.49e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YPL151C   Protein: S000006072
Sequence length 451
Comment PRP46 SGDID:S000006072, Chr XVI from 267534-266179, reverse complement, Verified ORF, "Splicing factor that is found in the Cef1p subcomplex of the spliceosome"
Sequence
MDGNDHKVENLGDVDKFYSRIRWNNQFSYMATLPPHLQSEMEGQKSLLMRYDTYRKESSS
FSGEGKKVTLQHVPTDFSEASQAVISKKDHDTHASAFVNKIFQPEVAEELIVNRYEKLLS
QRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG
HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA
TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT
MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQ
DDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEAD
KSIKIWKQDETATKESEPGLAWNPNLSAKRF
Download sequence
Identical sequences Q12417
YPL151C 4932.YPL151C YPL151C YPL151C YPL151C YPL151C YPL151c___KOG0285 YPL151C

Jump to [ Top of page · Domain architecture · Domain assignment details ]