SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPL152W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL152W-A   Protein: S000028721
Sequence length 32
Comment YPL152W-A SGDID:S000028721, Chr XVI from 264601-264699, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMVHLTLKSHLIKEELLWHALSPSYSCRYHGR
Download sequence
Identical sequences A6ZWA1 B3LKS5 Q8TGR9 W7PFN2 W7QRW8
YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A 4932.YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A tr|A6ZWA1|A6ZWA1_YEAS7 SCRT_02344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]