SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL152W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPL152W-A   Protein: S000028721
Sequence length 32
Comment YPL152W-A SGDID:S000028721, Chr XVI from 264601-264699, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMVHLTLKSHLIKEELLWHALSPSYSCRYHGR
Download sequence
Identical sequences A6ZWA1 B3LKS5 Q8TGR9
YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A YPL152W-A 4932.YPL152W-A YPL152W-A SCRT_02344 YPL152W-A tr|A6ZWA1|A6ZWA1_YEAS7 YPL152W-A YPL152W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]