SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL154C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL154C
Domain Number 1 Region: 8-43,75-404
Classification Level Classification E-value
Superfamily Acid proteases 9.77e-119
Family Pepsin-like 6.36e-12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.54 67.72
nucleotidyltransferase activity 1.652 7.83
DNA polymerase activity 2.239 7.83
small conjugating protein binding 2.027 4.45
Cellular Component IC (bits) H-Score
endocytic vesicle 1.434 15.57
external encapsulating structure 1.632 9.53
endosome 1.322 5.31
secretory granule 1.826 5.18
lytic vacuole 1.57 4.9
extracellular space 1.523 3.52

Protein sequence

External link(s) Locus: YPL154C   Protein: S000006075
Sequence length 405
Comment PEP4 SGDID:S000006075, Chr XVI from 260930-259713, reverse complement, Verified ORF, "Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates"
Sequence
MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEK
ANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSN
ECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAE
ATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTE
NGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI
TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGS
CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI
Download sequence
Identical sequences A6ZW99 B3LKS3 C8ZIM4 E7KIT9 E7KVG3 E7QA90 E7QL96 H0GPG9 N1NX07 P07267 W7PRF7 W7R4I1
YPL154C YPL154C 4932.YPL154C YPL154C YPL154C SCRT_02342 YPL154C YPL154C tr|A6ZW99|A6ZW99_YEAS7 YPL154C YPL154C YPL154C YPL154C YPL154C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]