SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL154C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL154C
Domain Number 1 Region: 8-43,75-404
Classification Level Classification E-value
Superfamily Acid proteases 9.77e-119
Family Pepsin-like 6.36e-12
Further Details:      
 

Protein sequence

External link(s) Locus: YPL154C   Protein: S000006075
Sequence length 405
Comment PEP4 SGDID:S000006075, Chr XVI from 260930-259713, reverse complement, Verified ORF, "Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates"
Sequence
MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEK
ANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSN
ECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAE
ATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTE
NGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI
TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGS
CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI
Download sequence
Identical sequences A6ZW99 B3LKS3 C8ZIM4 E7KIT9 E7KVG3 E7QA90 E7QL96 H0GPG9 P07267
YPL154C YPL154C 4932.YPL154C YPL154C YPL154C SCRT_02342 YPL154C YPL154C tr|A6ZW99|A6ZW99_YEAS7 YPL154C YPL154C YPL154C YPL154C YPL154C

Jump to [ Top of page · Domain architecture · Domain assignment details ]