SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL175W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL175W
Domain Number 1 Region: 1-377
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.06e-82
Family Glycosyl transferases group 1 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.334 39.89
endoplasmic reticulum subcompartment 1.536 18.39
external encapsulating structure 1.693 8.29
cell wall 1.808 8.29
plastid 1.489 8.1
nuclear outer membrane-endoplasmic reticulum membrane network 1.48 7.19
outer membrane 2.082 5.11

Protein sequence

External link(s) Locus: YPL175W   Protein: S000006096
Sequence length 452
Comment SPT14 SGDID:S000006096, Chr XVI from 218629-218645,218746-220087, Verified ORF, "UDP-GlcNAc-binding and catalytic subunit of the enzyme that mediates the first step in glycosylphosphatidylinositol (GPI) biosynthesis, mutations cause defects in transcription and in biogenesis of cell wall proteins"
Sequence
MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGVRHLTNGLKVY
HVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGSASTFAHEGILHANTMGLRTV
FTDHSLYGFNNLTSIWVNKLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAV
VSEDFKPRDPTGGTKRKQSRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAG
DGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAAS
CNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAINIIRSKALDTSSFHDSVSK
MYDWMDVAKRTVEIYTNISSTSSADDKDWMKMVANLYKRDGIWAKHLYLLCGIVEYMLFF
LLEWLYPRDEIDLAPKWPKKTVSNETKEARET
Download sequence
Identical sequences B3LKQ3 B5VSZ6 C8ZIK3 G2WP07 P32363 W7PFL5
YPL175W SCRT_02322 YPL175W YPL175W YPL175W YPL175W YPL175W YPL175W 4932.YPL175W YPL175W YPL175W YPL175W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]