SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPL220W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL220W
Domain Number 1 Region: 12-217
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.49e-60
Family Ribosomal protein L1 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.959 31.94
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 14.49
intracellular ribonucleoprotein complex 1.368 10.62
cytosol 1.295 10.44
nucleolus 1.732 5.2
cytosolic ribosome 2.235 4.63
mitochondrial matrix 1.611 4.09
organellar ribosome 2.107 4.09

Protein sequence

External link(s) Locus: YPL220W   Protein: S000006141
Sequence length 217
Comment RPL1A SGDID:S000006141, Chr XVI from 135789-136442, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal"
Sequence
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPR
PNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQV
PRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLV
NQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY
Download sequence
Identical sequences A0A0L8VQT8 A6ZU48 B3LHJ3 B5VIJ6 C7GN47 C8Z8B5 E7KCE2 E7KNB3 E7LU91 E7NHJ3 E7Q3R2 E7QEL3 G2WNW5 H0GPB5 N1P598 P0CX43 P0CX44
YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W 1s1iA YGL135W YPL220W YGL135W YPL220W YPL220W 3j6x.L1 3j6y.L1 3j77.L1 3j78.L1 4v4b.BA 4v6i.BA 4v7f.A 4v7r.BA 4v7r.DA 4v91.t 5fl8.I 5jcs.I 5juo.E 5jup.E 5jus.E 5jut.E 5juu.E YGL135W YPL220W 4932.YGL135W 4932.YPL220W YGL135W YPL220W YPL220W YGL135W YPL220W YGL135W YPL220W tr|A6ZU48|A6ZU48_YEAS7 ORFP:21446 ORFP:8073 YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W SCRT_01129 SCRT_02279 YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]