SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL220W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL220W
Domain Number 1 Region: 12-217
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.49e-60
Family Ribosomal protein L1 0.00013
Further Details:      
 

Protein sequence

External link(s) Locus: YPL220W   Protein: S000006141
Sequence length 217
Comment RPL1A SGDID:S000006141, Chr XVI from 135789-136442, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal"
Sequence
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPR
PNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQV
PRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLV
NQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY
Download sequence
Identical sequences A6ZU48 B3LHJ3 B5VIJ6 C7GN47 C8Z8B5 E7KCE2 E7KNB3 E7LU91 E7NHJ3 E7Q3R2 E7QEL3 G2WNW5 H0GPB5 N1P598 P0CX43 P0CX44 W7RKR4
YGL135W YPL220W 1s1iA YGL135W YPL220W ORFP:21446 ORFP:8073 YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W 4932.YGL135W 4932.YPL220W YGL135W YPL220W SCRT_01129 SCRT_02279 YGL135W YPL220W tr|A6ZU48|A6ZU48_YEAS7 1s1i.A 3izc.A 3izs.A 3o58.A 3o5h.A YGL135W YPL220W YGL135W YPL220W YGL135W YPL220W YPL220W YPL220W YPL220W

Jump to [ Top of page · Domain architecture · Domain assignment details ]