SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL241C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPL241C   Protein: S000006162
Sequence length 268
Comment CIN2 SGDID:S000006162, Chr XVI from 96258-96234,96153-95372, reverse complement, Verified ORF, "GTPase-activating protein (GAP) for Cin4p; tubulin folding factor C involved in beta-tubulin (Tub2p) folding; mutants display increased chromosome loss and benomyl sensitivity; deletion complemented by human GAP, retinitis pigmentosa 2"
Sequence
MDFTAKIKELERELSETSDYKTLQKKTISLRSELNTLSHSLTSYEKEHFSNDIENVLKSI
NAKLSESKGKKRLFSFKQKNSSSAVHKNVERTELANAPAYTTTLKKHYVLEKGDSAFENL
EFCTVTSTTDYSGNSALSGSLCFRNITKCVINLQRIFFQTGSIFITDCTDSIIFLRSPSD
KDFQIRLRDLKNCKILIEKLSPSIDCKQVVIIENCHKCIFNASTRDHLIIQDFSNPFQSE
ETEDNSAFAFEDFDICNKDTMQLFRAYL
Download sequence
Identical sequences B3LKJ1 C8ZID8 N1NXN5 P46670 W7PSU3 W7QUM2
YPL241C YPL241C 4932.YPL241C YPL241C YPL241C SCRT_02259 YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C

Jump to [ Top of page · Domain architecture · Domain assignment details ]