SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YPL241C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL241C   Protein: S000006162
Sequence length 268
Comment CIN2 SGDID:S000006162, Chr XVI from 96258-96234,96153-95372, reverse complement, Verified ORF, "GTPase-activating protein (GAP) for Cin4p; tubulin folding factor C involved in beta-tubulin (Tub2p) folding; mutants display increased chromosome loss and benomyl sensitivity; deletion complemented by human GAP, retinitis pigmentosa 2"
Sequence
MDFTAKIKELERELSETSDYKTLQKKTISLRSELNTLSHSLTSYEKEHFSNDIENVLKSI
NAKLSESKGKKRLFSFKQKNSSSAVHKNVERTELANAPAYTTTLKKHYVLEKGDSAFENL
EFCTVTSTTDYSGNSALSGSLCFRNITKCVINLQRIFFQTGSIFITDCTDSIIFLRSPSD
KDFQIRLRDLKNCKILIEKLSPSIDCKQVVIIENCHKCIFNASTRDHLIIQDFSNPFQSE
ETEDNSAFAFEDFDICNKDTMQLFRAYL
Download sequence
Identical sequences B3LKJ1 C8ZID8 N1NXN5 P46670 W7PSU3 W7QUM2
YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C 4932.YPL241C YPL241C SCRT_02259 YPL241C YPL241C YPL241C YPL241C YPL241C YPL241C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]