SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL248C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL248C
Domain Number 1 Region: 50-106
Classification Level Classification E-value
Superfamily Leucine zipper domain 1.97e-28
Family Leucine zipper domain 5.23e-05
Further Details:      
 
Domain Number 2 Region: 7-46
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 4.45e-09
Family Zn2/Cys6 DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.882 33.66
nucleoplasm part 1.418 8.58

Protein sequence

External link(s) Locus: YPL248C   Protein: S000006169
Sequence length 881
Comment GAL4 SGDID:S000006169, Chr XVI from 82356-79711, reverse complement, Verified ORF, "DNA-binding transcription factor required for the activation of the GAL genes in response to galactose; repressed by Gal80p and activated by Gal3p"
Sequence
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESR
LERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVETDMPL
TLRQHRISATSSSEESSNKGQRQLTVSIDSAAHHDNSTIPLDFMPRDALHGFDWSEEDDM
SDGLPFLKTDPNNNGFFGDGSLLCILRSIGFKPENYTNSNVNRLPTMITDRYTLASRSTT
SRLLQSYLNNFHPYCPIVHSPTLMMLYNNQIEIASKDQWQILFNCILAIGAWCIEGESTD
IDVFYYQNAKSHLTSKVFESGSIILVTALHLLSRYTQWRQKTNTSYNFHSFSIRMAISLG
LNRDLPSSFSDSSILEQRRRIWWSVYSWEIQLSLLYGRSIQLSQNTISFPSSVDDVQRTT
TGPTIYHGIIETARLLQVFTKIYELDKTVTAEKSPICAKKCLMICNEIEEVSRQAPKFLQ
MDISTTALTNLLKEHPWLSFTRFELKWKQLSLIIYVLRDFFTNFTQKKSQLEQDQNDHQS
YEVKRCSIMLSDAAQRTVMSVSSYMDNHNVTPYFAWNCSYYLFNAVLVPIKTLLSNSKSN
AENNETAQLLQQINTVLMLLKKLATFKIQTCEKYIQVLEEVCAPFLLSQCAIPLPHISYN
NSNGSAIKNIVGSATIAQYPTLPEENVNNISVKYVSPGSVGPSPVPLKSGASFSDLVKLL
SNRPPSRNSPVTIPRSTPSHRSVTPFLGQQQQLQSLVPLTPSALFGGANFNQSGNIADSS
LSFTFTNSSNGPNLITTQTNSQALSQPIASSNVHDNFMNNEITASKIDDGNNSKPLSPGW
TDQTAYNAFGITTGMFNTTTMDDVYNYLFDDEDTPPNPKKE
Download sequence
Identical sequences N1NVJ0 P04386 Q76MW9
YPL248C YPL248C 4932.YPL248C YPL248C CX00016 YPL248C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]