SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPL248C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL248C
Domain Number 1 Region: 50-106
Classification Level Classification E-value
Superfamily Leucine zipper domain 1.97e-28
Family Leucine zipper domain 5.23e-05
Further Details:      
 
Domain Number 2 Region: 7-46
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 4.45e-09
Family Zn2/Cys6 DNA-binding domain 0.00013
Further Details:      
 

Protein sequence

External link(s) Locus: YPL248C   Protein: S000006169
Sequence length 881
Comment GAL4 SGDID:S000006169, Chr XVI from 82356-79711, reverse complement, Verified ORF, "DNA-binding transcription factor required for the activation of the GAL genes in response to galactose; repressed by Gal80p and activated by Gal3p"
Sequence
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESR
LERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVETDMPL
TLRQHRISATSSSEESSNKGQRQLTVSIDSAAHHDNSTIPLDFMPRDALHGFDWSEEDDM
SDGLPFLKTDPNNNGFFGDGSLLCILRSIGFKPENYTNSNVNRLPTMITDRYTLASRSTT
SRLLQSYLNNFHPYCPIVHSPTLMMLYNNQIEIASKDQWQILFNCILAIGAWCIEGESTD
IDVFYYQNAKSHLTSKVFESGSIILVTALHLLSRYTQWRQKTNTSYNFHSFSIRMAISLG
LNRDLPSSFSDSSILEQRRRIWWSVYSWEIQLSLLYGRSIQLSQNTISFPSSVDDVQRTT
TGPTIYHGIIETARLLQVFTKIYELDKTVTAEKSPICAKKCLMICNEIEEVSRQAPKFLQ
MDISTTALTNLLKEHPWLSFTRFELKWKQLSLIIYVLRDFFTNFTQKKSQLEQDQNDHQS
YEVKRCSIMLSDAAQRTVMSVSSYMDNHNVTPYFAWNCSYYLFNAVLVPIKTLLSNSKSN
AENNETAQLLQQINTVLMLLKKLATFKIQTCEKYIQVLEEVCAPFLLSQCAIPLPHISYN
NSNGSAIKNIVGSATIAQYPTLPEENVNNISVKYVSPGSVGPSPVPLKSGASFSDLVKLL
SNRPPSRNSPVTIPRSTPSHRSVTPFLGQQQQLQSLVPLTPSALFGGANFNQSGNIADSS
LSFTFTNSSNGPNLITTQTNSQALSQPIASSNVHDNFMNNEITASKIDDGNNSKPLSPGW
TDQTAYNAFGITTGMFNTTTMDDVYNYLFDDEDTPPNPKKE
Download sequence
Identical sequences N1NVJ0 P04386 Q76MW9
YPL248C YPL248C 4932.YPL248C YPL248C CX00016 YPL248C

Jump to [ Top of page · Domain architecture · Domain assignment details ]