SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR002C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YPR002C-A   Protein: S000007254
Sequence length 65
Comment YPR002C-A SGDID:S000007254, Chr XVI from 560763-560566, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the Ty1 long terminal repeat, YPRWdelta12"
Sequence
MKAIILGIQNILEVLLEDIGILKMESIFLHTNITNIPHSVLYVSLSYYIINPCTSASSNL
DDSFS
Download sequence
Identical sequences Q6B0V7
YPR002C-A 4932.YPR002C-A YPR002C-A YPR002C-A YPR002C-A YPR002C-A YPR002C-A YT741 YPR002C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]