SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR002C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR002C-A   Protein: S000007254
Sequence length 65
Comment YPR002C-A SGDID:S000007254, Chr XVI from 560763-560566, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the Ty1 long terminal repeat, YPRWdelta12"
Sequence
MKAIILGIQNILEVLLEDIGILKMESIFLHTNITNIPHSVLYVSLSYYIINPCTSASSNL
DDSFS
Download sequence
Identical sequences Q6B0V7
YPR002C-A YPR002C-A YPR002C-A YPR002C-A YT741 4932.YPR002C-A YPR002C-A YPR002C-A YPR002C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]