SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR008W
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 9.15e-18
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0005
Further Details:      
 

Protein sequence

External link(s) Locus: YPR008W   Protein: S000006212
Sequence length 694
Comment HAA1 SGDID:S000006212, Chr XVI from 573015-575099, Verified ORF, "Transcriptional activator involved in the transcription of TPO2, HSP30 and other genes encoding membrane stress proteins; involved in adaptation to weak acid stress"
Sequence
MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCDYCKQLRKNKNANPEGV
CTCGRLEKKKLAQKAKEEARAKAKEKQRKQCTCGTDEVCKYHAQKRHLRKSPSSSQKKGR
SISRSQPMFERVLSSTSLDSNMLSGHGALSDTSSILTSTFLDSEPGVGKISKDYHHVPSL
ASISSLQSSQSLDQNFSIPQSPPLSSMSFNFLTGNINETNQNHSNHQHSKSGNNWQDSSV
SLPAKADSRLNMMDKNNSVGLDLLGHSKRISPISNSRVGEVSVPLEEYIPSDIDGVGRVT
DKSSLVYDWPFDESIERNFSTTATAATGESKFDINDNCNRINSKSYSKTNSMNGNGMNNS
NNNNINSNGNDKNNNNSSRQEHQGNGLFDMFTDSSSISTLSRANLLLQEKIGSQENSVKQ
ENYSKNPQLRHQLTSRSRSFIHHPANEYLKNTFGNSHSNDIGKGVEVLSLTPSFMDIPEK
ERETERSPSSNYITDRPFTRKPRSSSIDVNHRYPPMAPTTVATSPGALNNAVASNLDDQL
SLTSLNSQPSSIANMMMDPSNLAEQSSIHSVPQSINSPRMPKTGSRQDKNIHTKKEERNP
LNNIHDLSQLENVPDEMNQMFSPPLKSMNRPDAIRENSSSSNFIIQGNSMISTPSGRNDL
PDTSPMSSIQTASPPSQLLTDQGFADLDNFMSSL
Download sequence
Identical sequences B3LL69 Q12753
YPR008W 4932.YPR008W YPR008W YPR008W SCRT_02498 YPR008W YPR008W YPR008W YPR008W YPR008W YPR008W

Jump to [ Top of page · Domain architecture · Domain assignment details ]