SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR008W
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 9.15e-18
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR008W   Protein: S000006212
Sequence length 694
Comment HAA1 SGDID:S000006212, Chr XVI from 573015-575099, Verified ORF, "Transcriptional activator involved in the transcription of TPO2, HSP30 and other genes encoding membrane stress proteins; involved in adaptation to weak acid stress"
Sequence
MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCDYCKQLRKNKNANPEGV
CTCGRLEKKKLAQKAKEEARAKAKEKQRKQCTCGTDEVCKYHAQKRHLRKSPSSSQKKGR
SISRSQPMFERVLSSTSLDSNMLSGHGALSDTSSILTSTFLDSEPGVGKISKDYHHVPSL
ASISSLQSSQSLDQNFSIPQSPPLSSMSFNFLTGNINETNQNHSNHQHSKSGNNWQDSSV
SLPAKADSRLNMMDKNNSVGLDLLGHSKRISPISNSRVGEVSVPLEEYIPSDIDGVGRVT
DKSSLVYDWPFDESIERNFSTTATAATGESKFDINDNCNRINSKSYSKTNSMNGNGMNNS
NNNNINSNGNDKNNNNSSRQEHQGNGLFDMFTDSSSISTLSRANLLLQEKIGSQENSVKQ
ENYSKNPQLRHQLTSRSRSFIHHPANEYLKNTFGNSHSNDIGKGVEVLSLTPSFMDIPEK
ERETERSPSSNYITDRPFTRKPRSSSIDVNHRYPPMAPTTVATSPGALNNAVASNLDDQL
SLTSLNSQPSSIANMMMDPSNLAEQSSIHSVPQSINSPRMPKTGSRQDKNIHTKKEERNP
LNNIHDLSQLENVPDEMNQMFSPPLKSMNRPDAIRENSSSSNFIIQGNSMISTPSGRNDL
PDTSPMSSIQTASPPSQLLTDQGFADLDNFMSSL
Download sequence
Identical sequences B3LL69 N1NXF6 Q12753 W7P8U6 W7R3W2
YPR008W YPR008W 4932.YPR008W YPR008W YPR008W YPR008W SCRT_02498 YPR008W YPR008W YPR008W YPR008W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]