SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPR009W
Domain Number - Region: 130-155
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000115
Family Zn2/Cys6 DNA-binding domain 0.0052
Further Details:      
 

Protein sequence

External link(s) Locus: YPR009W   Protein: S000006213
Sequence length 268
Comment SUT2 SGDID:S000006213, Chr XVI from 576549-577355, Verified ORF, "Putative transcription factor; multicopy suppressor of mutations that cause low activity of the cAMP/protein kinase A pathway; highly similar to Sut1p"
Sequence
MKPNNRTCDVITNKDESLPALLLPALNSYTCDDSLLKGQISSNGRYQPFGFSDCSLLPKR
LNIQAGQGSMPVSSIQCADHSYSNWQKESEKTKLPKLGCPTEYTEYYKTVSSGETTDSAV
VSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDI
NQFRMKFFRKLPDVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF
PKINSKLKDKSIFEMTVDDYVAAGFQTL
Download sequence
Identical sequences B5VTH0 C7GV34 E7KJE6 Q12286
YPR009W 4932.YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W

Jump to [ Top of page · Domain architecture · Domain assignment details ]