SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YPR009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPR009W
Domain Number - Region: 130-155
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000115
Family Zn2/Cys6 DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR009W   Protein: S000006213
Sequence length 268
Comment SUT2 SGDID:S000006213, Chr XVI from 576549-577355, Verified ORF, "Putative transcription factor; multicopy suppressor of mutations that cause low activity of the cAMP/protein kinase A pathway; highly similar to Sut1p"
Sequence
MKPNNRTCDVITNKDESLPALLLPALNSYTCDDSLLKGQISSNGRYQPFGFSDCSLLPKR
LNIQAGQGSMPVSSIQCADHSYSNWQKESEKTKLPKLGCPTEYTEYYKTVSSGETTDSAV
VSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDI
NQFRMKFFRKLPDVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF
PKINSKLKDKSIFEMTVDDYVAAGFQTL
Download sequence
Identical sequences B5VTH0 C7GV34 E7KJE6 N1NW02 Q12286 W7PUS6
4932.YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W YPR009W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]